Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2618777..2619023 | Replicon | chromosome |
| Accession | NZ_CP117606 | ||
| Organism | Escherichia albertii strain BIA_29 | ||
Toxin (Protein)
| Gene name | hokX | Uniprot ID | S1PD89 |
| Locus tag | PS031_RS12890 | Protein ID | WP_000956458.1 |
| Coordinates | 2618777..2618929 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 2618971..2619023 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS031_RS12880 | 2614671..2615708 | + | 1038 | WP_059253936.1 | aminopeptidase | - |
| PS031_RS12885 | 2616043..2618582 | - | 2540 | Protein_2519 | CRISPR-associated helicase Cas3' | - |
| PS031_RS12890 | 2618777..2618929 | - | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
| - | 2618971..2619023 | + | 53 | - | - | Antitoxin |
| PS031_RS12895 | 2619194..2619928 | - | 735 | WP_001125132.1 | phosphoadenosine phosphosulfate reductase | - |
| PS031_RS12900 | 2620108..2621820 | - | 1713 | WP_131109610.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
| PS031_RS12905 | 2621820..2623619 | - | 1800 | WP_131109609.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271654 WP_000956458.1 NZ_CP117606:c2618929-2618777 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT271654 NZ_CP117606:2618971-2619023 [Escherichia albertii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|