Detailed information of TA system TA271646

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 778176..778401
• Replicon: chromosome
• Accession: NZ_CP117606
• Organism: Escherichia albertii strain BIA_29

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: -
• Locus tag: PS031_RS03705
• Protein ID: WP_198600732.1
• Coordinates: 778246..778401 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokA
Locus tag	-
Coordinates	778176..778234 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS031_RS03665	773814..774227	+	414	WP_098401685.1	DUF977 family protein	-
PS031_RS03670	774227..774517	+	291	WP_273772169.1	DUF4752 family protein	-
PS031_RS03675	774619..775787	+	1169	WP_137648127.1	IS3-like element IS911 family transposase	-
PS031_RS03680	775835..776263	+	429	WP_273773683.1	hypothetical protein	-
PS031_RS03685	776265..776621	+	357	WP_172953528.1	hypothetical protein	-
PS031_RS03690	776716..777120	+	405	WP_105198681.1	hypothetical protein	-
PS031_RS03695	777122..777331	+	210	WP_122998051.1	hypothetical protein	-
PS031_RS03700	777328..777954	+	627	WP_105198680.1	DUF551 domain-containing protein	-
-	778176..778234	-	59	-	-	Antitoxin
PS031_RS03705	778246..778401	+	156	WP_198600732.1	type I toxin-antitoxin system toxin HokD	Toxin
PS031_RS03710	778622..778882	+	261	WP_098401674.1	hypothetical protein	-
PS031_RS03715	778950..779228	+	279	WP_105198677.1	hypothetical protein	-
PS031_RS03720	779230..780288	+	1059	WP_105198676.1	DUF968 domain-containing protein	-
PS031_RS03725	780289..780666	+	378	WP_273772181.1	RusA family crossover junction endodeoxyribonuclease	-
PS031_RS03730	780656..781042	+	387	WP_059251056.1	antiterminator Q family protein	-
PS031_RS03735	781324..781911	+	588	WP_059251058.1	ORF6N domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integrative and Conjugative Element	-	ompA	748005..787186	39181

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5696.82 Da
• Isoelectric Point: 6.1531

>T271646 WP_198600732.1 NZ_CP117606:778246-778401 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVAALVTRKDLCEVRIRTGQTEVAVFTAYESEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271646 NZ_CP117606:c778234-778176 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Structures

Antitoxin