Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 14656..15302 | Replicon | plasmid pEA32_4 |
Accession | NZ_CP117604 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PS047_RS25745 | Protein ID | WP_273824034.1 |
Coordinates | 14955..15302 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS047_RS25740 | Protein ID | WP_001673379.1 |
Coordinates | 14656..14955 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS25705 (PS047_25705) | 10223..10762 | - | 540 | WP_273824033.1 | helix-turn-helix domain-containing protein | - |
PS047_RS25710 (PS047_25710) | 11208..11399 | + | 192 | WP_000183351.1 | hypothetical protein | - |
PS047_RS25715 (PS047_25715) | 11396..11743 | + | 348 | Protein_20 | ORF6N domain-containing protein | - |
PS047_RS25720 (PS047_25720) | 11912..12538 | + | 627 | WP_273824042.1 | Rha family transcriptional regulator | - |
PS047_RS25725 (PS047_25725) | 13354..13626 | - | 273 | WP_000148348.1 | helix-turn-helix domain-containing protein | - |
PS047_RS25730 (PS047_25730) | 13690..14070 | - | 381 | WP_000061763.1 | hypothetical protein | - |
PS047_RS25735 (PS047_25735) | 14338..14622 | + | 285 | WP_033816863.1 | hypothetical protein | - |
PS047_RS25740 (PS047_25740) | 14656..14955 | - | 300 | WP_001673379.1 | XRE family transcriptional regulator | Antitoxin |
PS047_RS25745 (PS047_25745) | 14955..15302 | - | 348 | WP_273824034.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS047_RS25750 (PS047_25750) | 15547..15810 | - | 264 | WP_273824035.1 | hypothetical protein | - |
PS047_RS25755 (PS047_25755) | 15834..16121 | - | 288 | WP_000356589.1 | hypothetical protein | - |
PS047_RS25760 (PS047_25760) | 16764..17744 | - | 981 | WP_249415694.1 | plasmid replication initiator RepA | - |
PS047_RS25765 (PS047_25765) | 18137..18670 | + | 534 | WP_273824036.1 | DapH/DapD/GlmU-related protein | - |
PS047_RS25770 (PS047_25770) | 18688..19830 | + | 1143 | WP_273824037.1 | lipopolysaccharide N-acetylglucosaminyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..49535 | 49535 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13530.45 Da Isoelectric Point: 8.8413
>T271644 WP_273824034.1 NZ_CP117604:c15302-14955 [Escherichia albertii]
MWTVLFSQRFNDWLNEQEDALQEKVLADLKNLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK
MWTVLFSQRFNDWLNEQEDALQEKVLADLKNLQVYGPELPRPYADTVKGSRYKNMKELRVQFSGRPIRAFYAFDPIRRAI
VLCAGDKSNDKRFYEKLVRIAEDEFAAHLNTLESK
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|