Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4075701..4076395 | Replicon | chromosome |
Accession | NZ_CP117600 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | PS047_RS20140 | Protein ID | WP_001263500.1 |
Coordinates | 4075997..4076395 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PS047_RS20135 | Protein ID | WP_000554758.1 |
Coordinates | 4075701..4075994 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS20115 (4071400) | 4071400..4071897 | + | 498 | WP_059275984.1 | transposase | - |
PS047_RS20120 (4072013) | 4072013..4073725 | - | 1713 | Protein_3919 | flagellar biosynthesis protein FlhA | - |
PS047_RS20125 (4073697) | 4073697..4074464 | + | 768 | WP_072243690.1 | putative lateral flagellar export/assembly protein LafU | - |
PS047_RS20130 (4074594) | 4074594..4075649 | + | 1056 | WP_059217800.1 | DNA polymerase IV | - |
PS047_RS20135 (4075701) | 4075701..4075994 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PS047_RS20140 (4075997) | 4075997..4076395 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PS047_RS20145 (4076405) | 4076405..4076857 | + | 453 | WP_072243685.1 | GNAT family N-acetyltransferase | - |
PS047_RS20150 (4076870) | 4076870..4077469 | + | 600 | WP_072249376.1 | peptide chain release factor H | - |
PS047_RS20155 (4077485) | 4077485..4077607 | + | 123 | Protein_3926 | metal-dependent hydrolase | - |
PS047_RS20160 (4077610) | 4077610..4077852 | - | 243 | WP_059222190.1 | hypothetical protein | - |
PS047_RS20165 (4077911) | 4077911..4079368 | - | 1458 | WP_001292996.1 | cytosol nonspecific dipeptidase | - |
PS047_RS20170 (4079629) | 4079629..4080087 | + | 459 | WP_273823547.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T271638 WP_001263500.1 NZ_CP117600:4075997-4076395 [Escherichia albertii]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|