Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3834364..3834622 | Replicon | chromosome |
Accession | NZ_CP117600 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | PS047_RS18990 | Protein ID | WP_000809168.1 |
Coordinates | 3834364..3834516 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3834565..3834622 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS18975 | 3829775..3831691 | + | 1917 | WP_059222122.1 | molecular chaperone DnaK | - |
PS047_RS18980 | 3831780..3832910 | + | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
PS047_RS18985 | 3833173..3834286 | - | 1114 | Protein_3699 | IS4-like element IS421 family transposase | - |
PS047_RS18990 | 3834364..3834516 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3834565..3834622 | + | 58 | - | - | Antitoxin |
PS047_RS18995 | 3835138..3835899 | + | 762 | WP_059278348.1 | outer membrane protein OmpK | - |
PS047_RS19000 | 3835920..3837413 | + | 1494 | WP_059278347.1 | sulfatase-like hydrolase/transferase | - |
PS047_RS19005 | 3837567..3838814 | + | 1248 | WP_059267798.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | espX1 | 3833173..3842752 | 9579 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271637 WP_000809168.1 NZ_CP117600:c3834516-3834364 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271637 NZ_CP117600:3834565-3834622 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|