Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2906553..2906810 | Replicon | chromosome |
Accession | NZ_CP117600 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | V0YDF1 |
Locus tag | PS047_RS14655 | Protein ID | WP_001135738.1 |
Coordinates | 2906553..2906705 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 2906762..2906810 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS14625 | 2902657..2903316 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
PS047_RS14630 | 2903420..2904394 | + | 975 | WP_059221283.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
PS047_RS14635 | 2904447..2905157 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
PS047_RS14640 | 2905580..2905870 | + | 291 | WP_059221281.1 | HTH-type transcriptional regulator | - |
PS047_RS14645 | 2906153..2906365 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
PS047_RS14650 | 2906505..2906576 | + | 72 | WP_212734940.1 | hypothetical protein | - |
PS047_RS14655 | 2906553..2906705 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 2906762..2906810 | + | 49 | - | - | Antitoxin |
PS047_RS14660 | 2907027..2909096 | - | 2070 | WP_059221279.1 | glycine--tRNA ligase subunit beta | - |
PS047_RS14665 | 2909106..2910017 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
PS047_RS14670 | 2910113..2910412 | - | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
PS047_RS14675 | 2910585..2911580 | + | 996 | WP_059221277.1 | acyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T271636 WP_001135738.1 NZ_CP117600:c2906705-2906553 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271636 NZ_CP117600:2906762-2906810 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|