Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 2832671..2833383 | Replicon | chromosome |
Accession | NZ_CP117600 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PS047_RS14330 | Protein ID | WP_059220983.1 |
Coordinates | 2832671..2832973 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS047_RS14335 | Protein ID | WP_000806446.1 |
Coordinates | 2833045..2833383 (+) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS14315 (2829534) | 2829534..2830376 | + | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
PS047_RS14320 (2830448) | 2830448..2831800 | + | 1353 | WP_054410173.1 | glutathione-disulfide reductase | - |
PS047_RS14325 (2831854) | 2831854..2831937 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
PS047_RS14330 (2832671) | 2832671..2832973 | + | 303 | WP_059220983.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS047_RS14335 (2833045) | 2833045..2833383 | + | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
PS047_RS14340 (2833440) | 2833440..2833619 | + | 180 | WP_002460167.1 | hypothetical protein | - |
PS047_RS14345 (2833956) | 2833956..2834528 | + | 573 | WP_273823453.1 | outer membrane lipoprotein Slp | - |
PS047_RS14350 (2834670) | 2834670..2835200 | + | 531 | WP_059220985.1 | LuxR C-terminal-related transcriptional regulator | - |
PS047_RS14355 (2835272) | 2835272..2836300 | - | 1029 | WP_001110409.1 | hematinate-forming heme oxygenase ChuS | - |
PS047_RS14360 (2836349) | 2836349..2838330 | - | 1982 | Protein_2812 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11885.61 Da Isoelectric Point: 9.8664
>T271635 WP_059220983.1 NZ_CP117600:2832671-2832973 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNDYSSIRVNNQYR
LIFKWVNGKAEDLYLAPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNDYSSIRVNNQYR
LIFKWVNGKAEDLYLAPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|