Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2021951..2022177 | Replicon | chromosome |
Accession | NZ_CP117600 | ||
Organism | Escherichia albertii strain BIA_32 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | - |
Locus tag | PS047_RS10415 | Protein ID | WP_273823841.1 |
Coordinates | 2021951..2022085 (-) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 2022130..2022177 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS047_RS10405 | 2017736..2020393 | - | 2658 | WP_059221338.1 | CRISPR-associated helicase/endonuclease Cas3 | - |
PS047_RS10410 | 2020646..2021758 | + | 1113 | WP_273823840.1 | IS4-like element IS421 family transposase | - |
PS047_RS10415 | 2021951..2022085 | - | 135 | WP_273823841.1 | Hok/Gef family protein | Toxin |
- | 2022130..2022177 | + | 48 | - | - | Antitoxin |
PS047_RS10420 | 2022349..2023083 | - | 735 | WP_001125132.1 | phosphoadenosine phosphosulfate reductase | - |
PS047_RS10425 | 2023162..2024874 | - | 1713 | WP_059221001.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS047_RS10430 | 2024874..2026673 | - | 1800 | WP_059221004.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4927.99 Da Isoelectric Point: 7.6784
>T271632 WP_273823841.1 NZ_CP117600:c2022085-2021951 [Escherichia albertii]
MLTKIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 135 bp
Antitoxin
Download Length: 48 bp
>AT271632 NZ_CP117600:2022130-2022177 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTG
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|