Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1067956..1068181 | Replicon | chromosome |
| Accession | NZ_CP117600 | ||
| Organism | Escherichia albertii strain BIA_32 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A8H9SPE4 |
| Locus tag | PS047_RS05500 | Protein ID | WP_001406737.1 |
| Coordinates | 1067956..1068111 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1068123..1068181 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS047_RS05450 | 1063169..1063384 | - | 216 | WP_000839596.1 | phage lysis protein EssD | - |
| PS047_RS05455 | 1064100..1064663 | + | 564 | WP_024246368.1 | DUF1440 domain-containing protein | - |
| PS047_RS05480 | 1065401..1066090 | - | 690 | WP_059222310.1 | bacteriophage antitermination protein Q | - |
| PS047_RS05485 | 1066087..1066452 | - | 366 | WP_054413016.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PS047_RS05490 | 1066453..1067508 | - | 1056 | WP_059276899.1 | DUF968 domain-containing protein | - |
| PS047_RS05495 | 1067510..1067788 | - | 279 | WP_072254332.1 | hypothetical protein | - |
| PS047_RS05500 | 1067956..1068111 | - | 156 | WP_001406737.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 1068123..1068181 | + | 59 | - | - | Antitoxin |
| PS047_RS05505 | 1068662..1068859 | - | 198 | Protein_1084 | DUF551 domain-containing protein | - |
| PS047_RS05510 | 1068839..1069009 | - | 171 | Protein_1085 | hypothetical protein | - |
| PS047_RS05515 | 1069006..1069413 | - | 408 | WP_137654438.1 | hypothetical protein | - |
| PS047_RS05520 | 1069572..1069987 | - | 416 | Protein_1087 | DUF977 family protein | - |
| PS047_RS05525 | 1069995..1070756 | - | 762 | WP_149508055.1 | DUF1627 domain-containing protein | - |
| PS047_RS05530 | 1070780..1071526 | - | 747 | WP_059227627.1 | ATP-binding protein | - |
| PS047_RS05535 | 1071533..1072495 | - | 963 | WP_273823734.1 | helix-turn-helix domain-containing protein | - |
| PS047_RS05540 | 1072519..1072944 | - | 426 | WP_273819617.1 | toxin YdaT family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleC / rhs/PAAR | 1033543..1090439 | 56896 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5794.93 Da Isoelectric Point: 4.8535
>T271630 WP_001406737.1 NZ_CP117600:c1068111-1067956 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271630 NZ_CP117600:1068123-1068181 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|