Detailed information of TA system TA271630

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 1067956..1068181
• Replicon: chromosome
• Accession: NZ_CP117600
• Organism: Escherichia albertii strain BIA_32

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: A0A8H9SPE4
• Locus tag: PS047_RS05500
• Protein ID: WP_001406737.1
• Coordinates: 1067956..1068111 (-)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	1068123..1068181 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS047_RS05450	1063169..1063384	-	216	WP_000839596.1	phage lysis protein EssD	-
PS047_RS05455	1064100..1064663	+	564	WP_024246368.1	DUF1440 domain-containing protein	-
PS047_RS05480	1065401..1066090	-	690	WP_059222310.1	bacteriophage antitermination protein Q	-
PS047_RS05485	1066087..1066452	-	366	WP_054413016.1	RusA family crossover junction endodeoxyribonuclease	-
PS047_RS05490	1066453..1067508	-	1056	WP_059276899.1	DUF968 domain-containing protein	-
PS047_RS05495	1067510..1067788	-	279	WP_072254332.1	hypothetical protein	-
PS047_RS05500	1067956..1068111	-	156	WP_001406737.1	type I toxin-antitoxin system toxin HokD	Toxin
-	1068123..1068181	+	59	-	-	Antitoxin
PS047_RS05505	1068662..1068859	-	198	Protein_1084	DUF551 domain-containing protein	-
PS047_RS05510	1068839..1069009	-	171	Protein_1085	hypothetical protein	-
PS047_RS05515	1069006..1069413	-	408	WP_137654438.1	hypothetical protein	-
PS047_RS05520	1069572..1069987	-	416	Protein_1087	DUF977 family protein	-
PS047_RS05525	1069995..1070756	-	762	WP_149508055.1	DUF1627 domain-containing protein	-
PS047_RS05530	1070780..1071526	-	747	WP_059227627.1	ATP-binding protein	-
PS047_RS05535	1071533..1072495	-	963	WP_273823734.1	helix-turn-helix domain-containing protein	-
PS047_RS05540	1072519..1072944	-	426	WP_273819617.1	toxin YdaT family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	nleC / rhs/PAAR	1033543..1090439	56896

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5794.93 Da
• Isoelectric Point: 4.8535

>T271630 WP_001406737.1 NZ_CP117600:c1068111-1067956 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271630 NZ_CP117600:1068123-1068181 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Structures

Antitoxin