Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 497823..498048 | Replicon | chromosome |
| Accession | NZ_CP117600 | ||
| Organism | Escherichia albertii strain BIA_32 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A7L6L988 |
| Locus tag | PS047_RS02585 | Protein ID | WP_000813269.1 |
| Coordinates | 497893..498048 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 497823..497881 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS047_RS02550 | 493336..494082 | + | 747 | WP_059259887.1 | ATP-binding protein | - |
| PS047_RS02555 | 494105..494867 | + | 763 | Protein_504 | DUF1627 domain-containing protein | - |
| PS047_RS02560 | 494875..495291 | + | 417 | WP_024229932.1 | DUF977 family protein | - |
| PS047_RS02565 | 495288..495551 | + | 264 | WP_024229931.1 | hypothetical protein | - |
| PS047_RS02570 | 495538..495849 | + | 312 | WP_032320575.1 | hypothetical protein | - |
| PS047_RS02575 | 495983..496537 | - | 555 | WP_024229929.1 | hypothetical protein | - |
| PS047_RS02580 | 496534..497466 | - | 933 | WP_059259885.1 | hypothetical protein | - |
| - | 497823..497881 | - | 59 | - | - | Antitoxin |
| PS047_RS02585 | 497893..498048 | + | 156 | WP_000813269.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| PS047_RS02590 | 498301..498378 | + | 78 | Protein_511 | hypothetical protein | - |
| PS047_RS02595 | 498534..499132 | + | 599 | Protein_512 | DUF1367 family protein | - |
| PS047_RS02600 | 499132..499422 | + | 291 | WP_059268185.1 | DUF1364 domain-containing protein | - |
| PS047_RS02605 | 499419..499961 | + | 543 | WP_048969771.1 | DUF1133 family protein | - |
| PS047_RS02610 | 500460..500795 | + | 336 | WP_001766841.1 | phage holin, lambda family | - |
| PS047_RS02615 | 500799..501275 | + | 477 | WP_001194114.1 | glycoside hydrolase family protein | - |
| PS047_RS02620 | 501259..501651 | + | 393 | WP_059277969.1 | DUF2570 domain-containing protein | - |
| PS047_RS02625 | 501536..501814 | + | 279 | WP_233991579.1 | hypothetical protein | - |
| PS047_RS02630 | 501859..501981 | + | 123 | WP_272946616.1 | hypothetical protein | - |
| PS047_RS02635 | 502100..502357 | + | 258 | Protein_520 | ParB/Srx family N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 482717..527080 | 44363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T271622 WP_000813269.1 NZ_CP117600:497893-498048 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271622 NZ_CP117600:c497881-497823 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|