Detailed information of TA system TA271622

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 497823..498048
• Replicon: chromosome
• Accession: NZ_CP117600
• Organism: Escherichia albertii strain BIA_32

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: A0A7L6L988
• Locus tag: PS047_RS02585
• Protein ID: WP_000813269.1
• Coordinates: 497893..498048 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	497823..497881 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS047_RS02550	493336..494082	+	747	WP_059259887.1	ATP-binding protein	-
PS047_RS02555	494105..494867	+	763	Protein_504	DUF1627 domain-containing protein	-
PS047_RS02560	494875..495291	+	417	WP_024229932.1	DUF977 family protein	-
PS047_RS02565	495288..495551	+	264	WP_024229931.1	hypothetical protein	-
PS047_RS02570	495538..495849	+	312	WP_032320575.1	hypothetical protein	-
PS047_RS02575	495983..496537	-	555	WP_024229929.1	hypothetical protein	-
PS047_RS02580	496534..497466	-	933	WP_059259885.1	hypothetical protein	-
-	497823..497881	-	59	-	-	Antitoxin
PS047_RS02585	497893..498048	+	156	WP_000813269.1	type I toxin-antitoxin system toxin HokD	Toxin
PS047_RS02590	498301..498378	+	78	Protein_511	hypothetical protein	-
PS047_RS02595	498534..499132	+	599	Protein_512	DUF1367 family protein	-
PS047_RS02600	499132..499422	+	291	WP_059268185.1	DUF1364 domain-containing protein	-
PS047_RS02605	499419..499961	+	543	WP_048969771.1	DUF1133 family protein	-
PS047_RS02610	500460..500795	+	336	WP_001766841.1	phage holin, lambda family	-
PS047_RS02615	500799..501275	+	477	WP_001194114.1	glycoside hydrolase family protein	-
PS047_RS02620	501259..501651	+	393	WP_059277969.1	DUF2570 domain-containing protein	-
PS047_RS02625	501536..501814	+	279	WP_233991579.1	hypothetical protein	-
PS047_RS02630	501859..501981	+	123	WP_272946616.1	hypothetical protein	-
PS047_RS02635	502100..502357	+	258	Protein_520	ParB/Srx family N-terminal domain-containing protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	482717..527080	44363

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5722.86 Da
• Isoelectric Point: 6.1531

>T271622 WP_000813269.1 NZ_CP117600:497893-498048 [Escherichia albertii]
MKQQKAMLVALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271622 NZ_CP117600:c497881-497823 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Structures

Toxin

• AlphaFold DB: A0A7L6L988

Antitoxin