Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 484274..484644 | Replicon | chromosome |
| Accession | NZ_CP117600 | ||
| Organism | Escherichia albertii strain BIA_32 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | A0A828GFM0 |
| Locus tag | PS047_RS02485 | Protein ID | WP_048969782.1 |
| Coordinates | 484450..484644 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 484274..484451 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS047_RS02455 (480051) | 480051..480224 | + | 174 | WP_032275239.1 | protein YnaL | - |
| PS047_RS02460 (480254) | 480254..481627 | + | 1374 | WP_059268187.1 | ATP-dependent RNA helicase DbpA | - |
| PS047_RS02465 (481730) | 481730..482665 | - | 936 | WP_044712357.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| PS047_RS02470 (482717) | 482717..483952 | - | 1236 | WP_273823679.1 | site-specific integrase | - |
| PS047_RS02475 (483954) | 483954..484169 | - | 216 | WP_048969784.1 | excisionase XisR | - |
| - (484274) | 484274..484451 | + | 178 | NuclAT_0 | - | Antitoxin |
| - (484274) | 484274..484451 | + | 178 | NuclAT_0 | - | Antitoxin |
| - (484274) | 484274..484451 | + | 178 | NuclAT_0 | - | Antitoxin |
| - (484274) | 484274..484451 | + | 178 | NuclAT_0 | - | Antitoxin |
| PS047_RS02480 (484269) | 484269..484457 | - | 189 | WP_048969783.1 | DUF1187 family protein | - |
| PS047_RS02485 (484450) | 484450..484644 | - | 195 | WP_048969782.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| PS047_RS02490 (484709) | 484709..485761 | - | 1053 | WP_048969781.1 | RecT family recombinase | - |
| PS047_RS02495 (485773) | 485773..488895 | - | 3123 | WP_273823680.1 | exodeoxyribonuclease VIII | - |
| PS047_RS02500 (488995) | 488995..489270 | - | 276 | WP_059278631.1 | hypothetical protein | - |
| PS047_RS02505 (489345) | 489345..489515 | - | 171 | WP_076735224.1 | YdaE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 482717..527080 | 44363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7128.14 Da Isoelectric Point: 8.9276
>T271619 WP_048969782.1 NZ_CP117600:c484644-484450 [Escherichia albertii]
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTAENINGGIYV
MRYEKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTAENINGGIYV
Download Length: 195 bp
Antitoxin
Download Length: 178 bp
>AT271619 NZ_CP117600:484274-484451 [Escherichia albertii]
AGGACTGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACTTTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCACCTTCCTTTTC
AATTGTGGCGGTAATTTT
AGGACTGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACTTTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCACCTTCCTTTTC
AATTGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
