Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31338..31592 | Replicon | plasmid pEA35_1 |
| Accession | NZ_CP117596 | ||
| Organism | Escherichia albertii strain BIA_35 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PS050_RS22930 | Protein ID | WP_001312851.1 |
| Coordinates | 31443..31592 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 31338..31399 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS050_RS22900 (26993) | 26993..28066 | + | 1074 | Protein_24 | conjugative transfer relaxase/helicase TraI | - |
| PS050_RS22905 (28086) | 28086..28832 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| PS050_RS22910 (28891) | 28891..29751 | + | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| PS050_RS22915 (29854) | 29854..30414 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PS050_RS22920 (30550) | 30550..30762 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PS050_RS22925 (31008) | 31008..31082 | + | 75 | Protein_29 | endonuclease | - |
| - (31338) | 31338..31399 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (31338) | 31338..31399 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (31338) | 31338..31399 | - | 62 | NuclAT_0 | - | Antitoxin |
| - (31338) | 31338..31399 | - | 62 | NuclAT_0 | - | Antitoxin |
| PS050_RS22930 (31443) | 31443..31592 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| PS050_RS22935 (31876) | 31876..32133 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PS050_RS22940 (32150) | 32150..32401 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| PS050_RS22945 (32392) | 32392..32439 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| PS050_RS22950 (32432) | 32432..32914 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| PS050_RS22955 (32907) | 32907..33764 | + | 858 | WP_000774296.1 | incFII family plasmid replication initiator RepA | - |
| PS050_RS22960 (34464) | 34464..34604 | + | 141 | WP_162789007.1 | hypothetical protein | - |
| PS050_RS22965 (34728) | 34728..34979 | + | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PS050_RS22970 (34976) | 34976..35263 | + | 288 | WP_000222774.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PS050_RS22975 (35433) | 35433..35837 | + | 405 | WP_000154256.1 | DUF2251 domain-containing protein | - |
| PS050_RS22980 (35838) | 35838..36026 | + | 189 | WP_128957842.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | espL2 / vat | 1..88900 | 88900 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T271612 WP_001312851.1 NZ_CP117596:31443-31592 [Escherichia albertii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT271612 NZ_CP117596:c31399-31338 [Escherichia albertii]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|