Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4529428..4530030 | Replicon | chromosome |
| Accession | NZ_CP117595 | ||
| Organism | Escherichia albertii strain BIA_35 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PS050_RS21820 | Protein ID | WP_059256930.1 |
| Coordinates | 4529719..4530030 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS050_RS21815 | Protein ID | WP_273818942.1 |
| Coordinates | 4529428..4529718 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS050_RS21780 (4524842) | 4524842..4525744 | + | 903 | WP_000331386.1 | formate dehydrogenase O subunit beta | - |
| PS050_RS21785 (4525741) | 4525741..4526376 | + | 636 | WP_000829019.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PS050_RS21790 (4526373) | 4526373..4527302 | + | 930 | WP_000027704.1 | formate dehydrogenase accessory protein FdhE | - |
| PS050_RS21795 (4527339) | 4527339..4527698 | - | 360 | Protein_4261 | type II toxin-antitoxin system VapC family toxin | - |
| PS050_RS21800 (4527698) | 4527698..4527940 | - | 243 | Protein_4262 | ribbon-helix-helix domain-containing protein | - |
| PS050_RS21805 (4528158) | 4528158..4528376 | - | 219 | WP_001251292.1 | CopG family transcriptional regulator | - |
| PS050_RS21810 (4528791) | 4528791..4529069 | - | 279 | WP_032278934.1 | hypothetical protein | - |
| PS050_RS21815 (4529428) | 4529428..4529718 | - | 291 | WP_273818942.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PS050_RS21820 (4529719) | 4529719..4530030 | - | 312 | WP_059256930.1 | hypothetical protein | Toxin |
| PS050_RS21825 (4530259) | 4530259..4531167 | + | 909 | WP_137651699.1 | alpha/beta hydrolase | - |
| PS050_RS21830 (4531233) | 4531233..4532174 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PS050_RS21835 (4532219) | 4532219..4532656 | - | 438 | WP_000560977.1 | D-aminoacyl-tRNA deacylase | - |
| PS050_RS21840 (4532653) | 4532653..4533525 | - | 873 | WP_000916663.1 | virulence factor BrkB family protein | - |
| PS050_RS21845 (4533519) | 4533519..4534118 | - | 600 | WP_002460585.1 | glucose-1-phosphatase | - |
| PS050_RS21850 (4534217) | 4534217..4535002 | - | 786 | WP_000059671.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12143.16 Da Isoelectric Point: 9.5486
>T271611 WP_059256930.1 NZ_CP117595:c4530030-4529719 [Escherichia albertii]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIC
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIC
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|