Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-ohsC/SymE(toxin) |
| Location | 4000803..4001215 | Replicon | chromosome |
| Accession | NZ_CP117595 | ||
| Organism | Escherichia albertii strain BIA_35 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | PS050_RS19325 | Protein ID | WP_000132603.1 |
| Coordinates | 4000874..4001215 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4000803..4000879 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS050_RS19315 (3997726) | 3997726..3999312 | + | 1587 | WP_001063209.1 | type I restriction-modification system methyltransferase | - |
| PS050_RS19320 (3999312) | 3999312..4000646 | + | 1335 | WP_000052067.1 | restriction endonuclease subunit S | - |
| - (4000803) | 4000803..4000879 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4000803) | 4000803..4000879 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4000803) | 4000803..4000879 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4000803) | 4000803..4000879 | - | 77 | NuclAT_8 | - | Antitoxin |
| - (4000803) | 4000803..4000879 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4000803) | 4000803..4000879 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4000803) | 4000803..4000879 | - | 77 | NuclAT_9 | - | Antitoxin |
| - (4000803) | 4000803..4000879 | - | 77 | NuclAT_9 | - | Antitoxin |
| PS050_RS19325 (4000874) | 4000874..4001215 | + | 342 | WP_000132603.1 | endoribonuclease SymE | Toxin |
| PS050_RS19330 (4001377) | 4001377..4002756 | + | 1380 | WP_010341339.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
| PS050_RS19335 (4002756) | 4002756..4003802 | + | 1047 | WP_015953744.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
| PS050_RS19340 (4003858) | 4003858..4004936 | - | 1079 | Protein_3787 | DUF1998 domain-containing protein | - |
| PS050_RS19345 (4005251) | 4005251..4006183 | - | 933 | WP_059255468.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12246.04 Da Isoelectric Point: 7.8259
>T271606 WP_000132603.1 NZ_CP117595:4000874-4001215 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRSPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRSPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271606 NZ_CP117595:c4000879-4000803 [Escherichia albertii]
AGTCATGATTACTATTCTCGTGAAATAGGGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATGATTACTATTCTCGTGAAATAGGGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|