Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 3924963..3925221 Replicon chromosome
Accession NZ_CP117595
Organism Escherichia albertii strain BIA_35

Toxin (Protein)


Gene name hokC Uniprot ID S1NX00
Locus tag PS050_RS18955 Protein ID WP_000809168.1
Coordinates 3925069..3925221 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 3924963..3925020 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS050_RS18930 3920212..3920892 - 681 Protein_3708 sulfatase-like hydrolase/transferase -
PS050_RS18935 3920977..3921999 + 1023 WP_273818787.1 IS21-like element IS100 family transposase -
PS050_RS18940 3921996..3922778 + 783 WP_001317493.1 IS21-like element IS100kyp family helper ATPase IstB -
PS050_RS18945 3922844..3923665 - 822 Protein_3711 sulfatase-like hydrolase/transferase -
PS050_RS18950 3923686..3924447 - 762 WP_054409892.1 outer membrane protein OmpK -
- 3924963..3925020 - 58 - - Antitoxin
PS050_RS18955 3925069..3925221 + 153 WP_000809168.1 type I toxin-antitoxin system toxin MokC Toxin
PS050_RS18960 3925299..3926411 + 1113 WP_074014158.1 IS4-like element IS421 family transposase -
PS050_RS18965 3926674..3927804 - 1131 WP_273818822.1 molecular chaperone DnaJ -
PS050_RS18970 3927893..3929824 - 1932 WP_001470959.1 molecular chaperone DnaK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - espX1 3916046..3925221 9175
- inside IScluster/Tn - - 3920977..3926574 5597


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5501.57 Da        Isoelectric Point: 7.1312

>T271605 WP_000809168.1 NZ_CP117595:3925069-3925221 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT271605 NZ_CP117595:c3925020-3924963 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1NX00

Antitoxin

Download structure file

References