Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1108356..1108602 | Replicon | chromosome |
Accession | NZ_CP117595 | ||
Organism | Escherichia albertii strain BIA_35 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | PS050_RS05365 | Protein ID | WP_000956458.1 |
Coordinates | 1108450..1108602 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1108356..1108408 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS050_RS05350 | 1103760..1105559 | + | 1800 | WP_161538532.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
PS050_RS05355 | 1105559..1107271 | + | 1713 | WP_161538531.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS050_RS05360 | 1107451..1108185 | + | 735 | WP_001125132.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1108356..1108408 | - | 53 | - | - | Antitoxin |
PS050_RS05365 | 1108450..1108602 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
PS050_RS05370 | 1108795..1109907 | - | 1113 | WP_273819074.1 | IS4 family transposase | - |
PS050_RS05375 | 1110160..1112817 | + | 2658 | WP_273819075.1 | CRISPR-associated helicase Cas3' | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271598 WP_000956458.1 NZ_CP117595:1108450-1108602 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT271598 NZ_CP117595:c1108408-1108356 [Escherichia albertii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|