Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 807643..808442 | Replicon | chromosome |
| Accession | NZ_CP117595 | ||
| Organism | Escherichia albertii strain BIA_35 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
| Locus tag | PS050_RS03960 | Protein ID | WP_059227548.1 |
| Coordinates | 807643..808107 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | PS050_RS03965 | Protein ID | WP_001296435.1 |
| Coordinates | 808107..808442 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS050_RS03930 (802644) | 802644..803078 | - | 435 | WP_000948821.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| PS050_RS03935 (803096) | 803096..803974 | - | 879 | WP_059256166.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PS050_RS03940 (803964) | 803964..804743 | - | 780 | WP_141109251.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PS050_RS03945 (804754) | 804754..805227 | - | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PS050_RS03950 (805250) | 805250..806530 | - | 1281 | WP_059216469.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PS050_RS03955 (806779) | 806779..807588 | + | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
| PS050_RS03960 (807643) | 807643..808107 | - | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PS050_RS03965 (808107) | 808107..808442 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PS050_RS03970 (808591) | 808591..810162 | - | 1572 | WP_273819048.1 | galactarate dehydratase | - |
| PS050_RS03975 (810532) | 810532..811866 | + | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PS050_RS03980 (811882) | 811882..812652 | + | 771 | WP_001063508.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T271596 WP_059227548.1 NZ_CP117595:c808107-807643 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|