Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3703905..3704555 | Replicon | chromosome |
Accession | NZ_CP117590 | ||
Organism | Escherichia albertii strain BIA_36 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PS051_RS18515 | Protein ID | WP_149508045.1 |
Coordinates | 3704214..3704555 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS051_RS18510 | Protein ID | WP_273781312.1 |
Coordinates | 3703905..3704204 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS051_RS18485 (3699120) | 3699120..3699431 | - | 312 | WP_000410252.1 | hypothetical protein | - |
PS051_RS18490 (3699436) | 3699436..3699828 | - | 393 | WP_000273381.1 | flagellar export chaperone FliS | - |
PS051_RS18495 (3699851) | 3699851..3701167 | - | 1317 | WP_273781308.1 | flagellar filament capping protein FliD | - |
PS051_RS18500 (3701594) | 3701594..3702508 | - | 915 | WP_273781310.1 | lateral flagellin LafA | - |
PS051_RS18505 (3702995) | 3702995..3703847 | + | 853 | Protein_3616 | winged helix-turn-helix domain-containing protein | - |
PS051_RS18510 (3703905) | 3703905..3704204 | - | 300 | WP_273781312.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PS051_RS18515 (3704214) | 3704214..3704555 | - | 342 | WP_149508045.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS051_RS18520 (3704631) | 3704631..3705608 | - | 978 | WP_273781313.1 | flagellar hook-associated protein | - |
PS051_RS18525 (3705625) | 3705625..3706554 | - | 930 | WP_025237548.1 | flagellar hook-associated protein FlgL | - |
PS051_RS18530 (3706569) | 3706569..3707945 | - | 1377 | WP_273781314.1 | flagellar hook-associated protein FlgK | - |
PS051_RS18535 (3708134) | 3708134..3708433 | - | 300 | WP_000867179.1 | rod-binding protein | - |
PS051_RS18540 (3708433) | 3708433..3709533 | - | 1101 | WP_273781315.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12972.79 Da Isoelectric Point: 5.7334
>T271579 WP_149508045.1 NZ_CP117590:c3704555-3704214 [Escherichia albertii]
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYPKHLKK
MWDVETTETFDNWFDAQTVALKEDLLAAMLILAEYGPQLGRPFADTVNDSQFSNMKELRVQHQGNPVRAFFAFDPARRGI
VLCAGDKTGLNEKKFYRDMIKLADSEYPKHLKK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|