Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3693135..3693829 | Replicon | chromosome |
| Accession | NZ_CP117590 | ||
| Organism | Escherichia albertii strain BIA_36 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | PS051_RS18445 | Protein ID | WP_001263500.1 |
| Coordinates | 3693135..3693533 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PS051_RS18450 | Protein ID | WP_000554758.1 |
| Coordinates | 3693536..3693829 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS051_RS18415 (3689443) | 3689443..3689901 | - | 459 | WP_001291989.1 | xanthine phosphoribosyltransferase | - |
| PS051_RS18420 (3690162) | 3690162..3691619 | + | 1458 | WP_001292996.1 | cytosol nonspecific dipeptidase | - |
| PS051_RS18425 (3691678) | 3691678..3691920 | + | 243 | WP_059222190.1 | hypothetical protein | - |
| PS051_RS18430 (3691923) | 3691923..3692045 | - | 123 | Protein_3601 | metal-dependent hydrolase | - |
| PS051_RS18435 (3692061) | 3692061..3692660 | - | 600 | WP_072249376.1 | peptide chain release factor H | - |
| PS051_RS18440 (3692673) | 3692673..3693125 | - | 453 | WP_072243685.1 | GNAT family N-acetyltransferase | - |
| PS051_RS18445 (3693135) | 3693135..3693533 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PS051_RS18450 (3693536) | 3693536..3693829 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PS051_RS18455 (3693881) | 3693881..3694936 | - | 1056 | WP_059217800.1 | DNA polymerase IV | - |
| PS051_RS18460 (3695066) | 3695066..3695971 | - | 906 | WP_025237542.1 | putative lateral flagellar export/assembly protein LafU | - |
| PS051_RS18465 (3695974) | 3695974..3696837 | - | 864 | WP_001169515.1 | flagellar motor stator protein MotA | - |
| PS051_RS18470 (3696850) | 3696850..3697566 | - | 717 | WP_273781306.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| PS051_RS18475 (3697587) | 3697587..3698051 | - | 465 | WP_059278868.1 | flagellar basal body-associated FliL family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T271578 WP_001263500.1 NZ_CP117590:c3693533-3693135 [Escherichia albertii]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|