Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2809885..2810110 | Replicon | chromosome |
| Accession | NZ_CP117590 | ||
| Organism | Escherichia albertii strain BIA_36 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A8H9SPE4 |
| Locus tag | PS051_RS14190 | Protein ID | WP_001406737.1 |
| Coordinates | 2809885..2810040 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2810052..2810110 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS051_RS14160 | 2805942..2806124 | - | 183 | WP_213788356.1 | hypothetical protein | - |
| PS051_RS14165 | 2806136..2807656 | - | 1521 | Protein_2772 | terminase large subunit | - |
| PS051_RS14170 | 2807664..2808014 | - | 351 | WP_000532209.1 | antiterminator Q family protein | - |
| PS051_RS14175 | 2808004..2808381 | - | 378 | WP_262938790.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PS051_RS14180 | 2808382..2809437 | - | 1056 | WP_273780949.1 | DUF968 domain-containing protein | - |
| PS051_RS14185 | 2809439..2809717 | - | 279 | WP_262938793.1 | hypothetical protein | - |
| PS051_RS14190 | 2809885..2810040 | - | 156 | WP_001406737.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2810052..2810110 | + | 59 | - | - | Antitoxin |
| PS051_RS14195 | 2810509..2810667 | + | 159 | WP_273780951.1 | cell division inhibition protein DicB | - |
| PS051_RS14200 | 2810664..2811086 | + | 423 | WP_273780952.1 | 3'-5' exonuclease | - |
| PS051_RS14205 | 2811148..2811417 | + | 270 | WP_137585494.1 | excisionase | - |
| PS051_RS14210 | 2811386..2812504 | + | 1119 | WP_032083071.1 | phage integrase Arm DNA-binding domain-containing protein | - |
| PS051_RS14215 | 2812671..2813465 | + | 795 | WP_065793203.1 | spermidine/putrescine ABC transporter permease PotC | - |
| PS051_RS14220 | 2813462..2814508 | + | 1047 | WP_059219729.1 | spermidine/putrescine ABC transporter substrate-binding protein PotD | - |
| PS051_RS14225 | 2814566..2815027 | + | 462 | WP_059219730.1 | DUF3592 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2787155..2819674 | 32519 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5794.93 Da Isoelectric Point: 4.8535
>T271576 WP_001406737.1 NZ_CP117590:c2810040-2809885 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271576 NZ_CP117590:2810052-2810110 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|