Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2809885..2810110 Replicon chromosome
Accession NZ_CP117590
Organism Escherichia albertii strain BIA_36

Toxin (Protein)


Gene name hokW Uniprot ID A0A8H9SPE4
Locus tag PS051_RS14190 Protein ID WP_001406737.1
Coordinates 2809885..2810040 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2810052..2810110 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS051_RS14160 2805942..2806124 - 183 WP_213788356.1 hypothetical protein -
PS051_RS14165 2806136..2807656 - 1521 Protein_2772 terminase large subunit -
PS051_RS14170 2807664..2808014 - 351 WP_000532209.1 antiterminator Q family protein -
PS051_RS14175 2808004..2808381 - 378 WP_262938790.1 RusA family crossover junction endodeoxyribonuclease -
PS051_RS14180 2808382..2809437 - 1056 WP_273780949.1 DUF968 domain-containing protein -
PS051_RS14185 2809439..2809717 - 279 WP_262938793.1 hypothetical protein -
PS051_RS14190 2809885..2810040 - 156 WP_001406737.1 type I toxin-antitoxin system toxin HokD Toxin
- 2810052..2810110 + 59 - - Antitoxin
PS051_RS14195 2810509..2810667 + 159 WP_273780951.1 cell division inhibition protein DicB -
PS051_RS14200 2810664..2811086 + 423 WP_273780952.1 3'-5' exonuclease -
PS051_RS14205 2811148..2811417 + 270 WP_137585494.1 excisionase -
PS051_RS14210 2811386..2812504 + 1119 WP_032083071.1 phage integrase Arm DNA-binding domain-containing protein -
PS051_RS14215 2812671..2813465 + 795 WP_065793203.1 spermidine/putrescine ABC transporter permease PotC -
PS051_RS14220 2813462..2814508 + 1047 WP_059219729.1 spermidine/putrescine ABC transporter substrate-binding protein PotD -
PS051_RS14225 2814566..2815027 + 462 WP_059219730.1 DUF3592 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2787155..2819674 32519


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5794.93 Da        Isoelectric Point: 4.8535

>T271576 WP_001406737.1 NZ_CP117590:c2810040-2809885 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTDQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271576 NZ_CP117590:2810052-2810110 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References