Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2552282..2552507 Replicon chromosome
Accession NZ_CP117590
Organism Escherichia albertii strain BIA_36

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag PS051_RS12850 Protein ID WP_000813254.1
Coordinates 2552282..2552437 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2552449..2552507 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS051_RS12805 2547878..2548063 - 186 WP_001228693.1 Rz1 family lipoprotein -
PS051_RS12810 2548280..2548777 - 498 WP_001135280.1 lysozyme RrrD -
PS051_RS12815 2548777..2548992 - 216 WP_000839596.1 phage lysis protein EssD -
PS051_RS12830 2550277..2550819 - 543 WP_000640136.1 DUF1133 family protein -
PS051_RS12835 2550816..2551106 - 291 WP_273780812.1 DUF1364 domain-containing protein -
PS051_RS12840 2551106..2551705 - 600 WP_000940323.1 DUF1367 family protein -
PS051_RS12845 2551744..2552032 - 289 Protein_2510 hypothetical protein -
PS051_RS12850 2552282..2552437 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2552449..2552507 + 59 - - Antitoxin
PS051_RS12855 2552962..2553342 + 381 WP_273780813.1 KilA-N domain-containing protein -
PS051_RS12860 2553388..2554116 - 729 Protein_2513 IS5 family transposase -
PS051_RS12870 2555367..2555609 - 243 Protein_2515 transposase -
PS051_RS12875 2555662..2556054 + 393 WP_273780814.1 hypothetical protein -
PS051_RS12880 2556547..2556669 - 123 Protein_2517 dTDP-6-deoxy-L-hexose 3-O-methyltransferase -
PS051_RS12885 2556672..2556888 - 217 Protein_2518 DUF4014 family protein -
PS051_RS12890 2557022..2557327 - 306 WP_213836069.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2510278..2571144 60866


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T271575 WP_000813254.1 NZ_CP117590:c2552437-2552282 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271575 NZ_CP117590:2552449-2552507 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References