Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2552282..2552507 | Replicon | chromosome |
| Accession | NZ_CP117590 | ||
| Organism | Escherichia albertii strain BIA_36 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | PS051_RS12850 | Protein ID | WP_000813254.1 |
| Coordinates | 2552282..2552437 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2552449..2552507 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS051_RS12805 | 2547878..2548063 | - | 186 | WP_001228693.1 | Rz1 family lipoprotein | - |
| PS051_RS12810 | 2548280..2548777 | - | 498 | WP_001135280.1 | lysozyme RrrD | - |
| PS051_RS12815 | 2548777..2548992 | - | 216 | WP_000839596.1 | phage lysis protein EssD | - |
| PS051_RS12830 | 2550277..2550819 | - | 543 | WP_000640136.1 | DUF1133 family protein | - |
| PS051_RS12835 | 2550816..2551106 | - | 291 | WP_273780812.1 | DUF1364 domain-containing protein | - |
| PS051_RS12840 | 2551106..2551705 | - | 600 | WP_000940323.1 | DUF1367 family protein | - |
| PS051_RS12845 | 2551744..2552032 | - | 289 | Protein_2510 | hypothetical protein | - |
| PS051_RS12850 | 2552282..2552437 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2552449..2552507 | + | 59 | - | - | Antitoxin |
| PS051_RS12855 | 2552962..2553342 | + | 381 | WP_273780813.1 | KilA-N domain-containing protein | - |
| PS051_RS12860 | 2553388..2554116 | - | 729 | Protein_2513 | IS5 family transposase | - |
| PS051_RS12870 | 2555367..2555609 | - | 243 | Protein_2515 | transposase | - |
| PS051_RS12875 | 2555662..2556054 | + | 393 | WP_273780814.1 | hypothetical protein | - |
| PS051_RS12880 | 2556547..2556669 | - | 123 | Protein_2517 | dTDP-6-deoxy-L-hexose 3-O-methyltransferase | - |
| PS051_RS12885 | 2556672..2556888 | - | 217 | Protein_2518 | DUF4014 family protein | - |
| PS051_RS12890 | 2557022..2557327 | - | 306 | WP_213836069.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2510278..2571144 | 60866 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T271575 WP_000813254.1 NZ_CP117590:c2552437-2552282 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT271575 NZ_CP117590:2552449-2552507 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|