Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2516228..2516634 | Replicon | chromosome |
Accession | NZ_CP117590 | ||
Organism | Escherichia albertii strain BIA_36 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | - |
Locus tag | PS051_RS12640 | Protein ID | WP_059268219.1 |
Coordinates | 2516228..2516458 (+) | Length | 77 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2516457..2516634 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS051_RS12605 (2511521) | 2511521..2512081 | - | 561 | WP_059217651.1 | T3SS effector NleG family protein | - |
PS051_RS12610 (2512196) | 2512196..2512375 | - | 180 | Protein_2465 | phage tail fiber C-terminal domain-containing protein | - |
PS051_RS12615 (2513132) | 2513132..2513470 | - | 339 | Protein_2466 | prophage tail fiber N-terminal domain-containing protein | - |
PS051_RS12620 (2513531) | 2513531..2514655 | - | 1125 | Protein_2467 | DUF1983 domain-containing protein | - |
PS051_RS12625 (2514644) | 2514644..2514769 | + | 126 | Protein_2468 | host-nuclease inhibitor Gam family protein | - |
PS051_RS12630 (2514775) | 2514775..2515554 | + | 780 | WP_000100866.1 | phage recombination protein Bet | - |
PS051_RS12635 (2515551) | 2515551..2516231 | + | 681 | WP_059279422.1 | YqaJ viral recombinase family protein | - |
PS051_RS12640 (2516228) | 2516228..2516458 | + | 231 | WP_059268219.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
- (2516457) | 2516457..2516634 | - | 178 | NuclAT_1 | - | Antitoxin |
- (2516457) | 2516457..2516634 | - | 178 | NuclAT_1 | - | Antitoxin |
- (2516457) | 2516457..2516634 | - | 178 | NuclAT_1 | - | Antitoxin |
- (2516457) | 2516457..2516634 | - | 178 | NuclAT_1 | - | Antitoxin |
PS051_RS12645 (2516451) | 2516451..2516639 | + | 189 | WP_048969783.1 | DUF1187 family protein | - |
PS051_RS12650 (2516739) | 2516739..2516954 | + | 216 | WP_048969784.1 | excisionase XisR | - |
PS051_RS12655 (2516956) | 2516956..2518191 | + | 1236 | WP_273780770.1 | site-specific integrase | - |
PS051_RS12660 (2519081) | 2519081..2520034 | + | 954 | WP_001516440.1 | omptin family outer membrane protease OmpT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2510278..2571144 | 60866 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 77 a.a. Molecular weight: 8313.48 Da Isoelectric Point: 9.2288
>T271572 WP_059268219.1 NZ_CP117590:2516228-2516458 [Escherichia albertii]
MSAATKLTGEKPERYTKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTAENINGGIYV
MSAATKLTGEKPERYTKVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTAENINGGIYV
Download Length: 231 bp
Antitoxin
Download Length: 178 bp
>AT271572 NZ_CP117590:c2516634-2516457 [Escherichia albertii]
AGGACTGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACTTTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCACCTTCCTTTTC
AATTGTGGCGGTAATTTT
AGGACTGAAGTTTCTCGCAATTAAAATTCATCAGTTTTACTTTTTGCTCTCTGGAAACGCCTGCTTCTTTTTTCCCTGAG
AGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTACCACCTTCCTTTTC
AATTGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|