Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 229847..230559 | Replicon | chromosome |
Accession | NZ_CP117590 | ||
Organism | Escherichia albertii strain BIA_36 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PS051_RS01030 | Protein ID | WP_273781541.1 |
Coordinates | 230257..230559 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS051_RS01025 | Protein ID | WP_000806446.1 |
Coordinates | 229847..230185 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS051_RS01000 (224904) | 224904..226886 | + | 1983 | WP_273781540.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
PS051_RS01005 (226935) | 226935..227963 | + | 1029 | WP_001110409.1 | hematinate-forming heme oxygenase ChuS | - |
PS051_RS01010 (228035) | 228035..228565 | - | 531 | WP_059220985.1 | LuxR C-terminal-related transcriptional regulator | - |
PS051_RS01015 (228712) | 228712..229278 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
PS051_RS01020 (229611) | 229611..229790 | - | 180 | WP_002460167.1 | hypothetical protein | - |
PS051_RS01025 (229847) | 229847..230185 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
PS051_RS01030 (230257) | 230257..230559 | - | 303 | WP_273781541.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS051_RS01035 (230723) | 230723..231217 | + | 495 | WP_273781542.1 | hypothetical protein | - |
PS051_RS01040 (231293) | 231293..231376 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
PS051_RS01045 (231430) | 231430..232782 | - | 1353 | WP_273781543.1 | glutathione-disulfide reductase | - |
PS051_RS01050 (232854) | 232854..233696 | - | 843 | WP_113650511.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11827.58 Da Isoelectric Point: 10.0443
>T271563 WP_273781541.1 NZ_CP117590:c230559-230257 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLAPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLAPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|