Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 4121301..4121713 | Replicon | chromosome |
Accession | NZ_CP117586 | ||
Organism | Escherichia albertii strain BIA_40 |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | PS042_RS20435 | Protein ID | WP_059225014.1 |
Coordinates | 4121372..4121713 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 4121301..4121377 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS042_RS20425 (4118215) | 4118215..4119803 | + | 1589 | Protein_3987 | type I restriction-modification system methyltransferase | - |
PS042_RS20430 (4119800) | 4119800..4121143 | + | 1344 | WP_059235087.1 | restriction endonuclease subunit S | - |
- (4121301) | 4121301..4121377 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4121301) | 4121301..4121377 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4121301) | 4121301..4121377 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4121301) | 4121301..4121377 | - | 77 | NuclAT_8 | - | Antitoxin |
- (4121301) | 4121301..4121377 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4121301) | 4121301..4121377 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4121301) | 4121301..4121377 | - | 77 | NuclAT_9 | - | Antitoxin |
- (4121301) | 4121301..4121377 | - | 77 | NuclAT_9 | - | Antitoxin |
PS042_RS20435 (4121372) | 4121372..4121713 | + | 342 | WP_059225014.1 | endoribonuclease SymE | Toxin |
PS042_RS20440 (4121760) | 4121760..4122926 | - | 1167 | WP_077629336.1 | DUF1524 domain-containing protein | - |
PS042_RS20445 (4122980) | 4122980..4123856 | - | 877 | Protein_3991 | DUF262 domain-containing protein | - |
PS042_RS20450 (4124081) | 4124081..4124254 | + | 174 | Protein_3992 | GntR family transcriptional regulator | - |
PS042_RS20455 (4124407) | 4124407..4125339 | - | 933 | WP_059242218.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12384.20 Da Isoelectric Point: 7.8219
>T271555 WP_059225014.1 NZ_CP117586:4121372-4121713 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271555 NZ_CP117586:c4121377-4121301 [Escherichia albertii]
AGTCATGATTACTATTCTCCATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATGATTACTATTCTCCATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|