Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2866680..2866905 Replicon chromosome
Accession NZ_CP117586
Organism Escherichia albertii strain BIA_40

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag PS042_RS14300 Protein ID WP_000813254.1
Coordinates 2866680..2866835 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2866847..2866905 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS042_RS14245 2862078..2862428 - 351 WP_000193280.1 YdfR family protein -
PS042_RS14250 2862433..2862648 - 216 WP_000839572.1 class II holin family protein -
PS042_RS14275 2863460..2864149 - 690 WP_001064896.1 bacteriophage antitermination protein Q -
PS042_RS14280 2864146..2864511 - 366 WP_000139992.1 RusA family crossover junction endodeoxyribonuclease -
PS042_RS14285 2864512..2865567 - 1056 WP_024188444.1 DUF968 domain-containing protein -
PS042_RS14290 2865569..2865847 - 279 WP_024175747.1 hypothetical protein -
PS042_RS14295 2866144..2866536 - 393 WP_000737636.1 hypothetical protein -
PS042_RS14300 2866680..2866835 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2866847..2866905 + 59 - - Antitoxin
PS042_RS14305 2867422..2868447 - 1026 WP_029397198.1 DUF5677 domain-containing protein -
PS042_RS14310 2868675..2869100 - 426 WP_046080786.1 DUF977 family protein -
PS042_RS14315 2869141..2870211 - 1071 WP_256904042.1 phage replisome organizer -
PS042_RS14320 2870283..2870708 - 426 WP_000693850.1 toxin YdaT family protein -
PS042_RS14325 2870705..2870920 - 216 WP_060615121.1 Cro/CI family transcriptional regulator -
PS042_RS14330 2871012..2871686 + 675 WP_223737828.1 S24 family peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2837130..2885056 47926


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T271551 WP_000813254.1 NZ_CP117586:c2866835-2866680 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271551 NZ_CP117586:2866847-2866905 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References