Detailed information of TA system TA271548

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2435008..2435233
• Replicon: chromosome
• Accession: NZ_CP117586
• Organism: Escherichia albertii strain BIA_40

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: S1ELB5
• Locus tag: PS042_RS12180
• Protein ID: WP_000813254.1
• Coordinates: 2435078..2435233 (+)
• Length: 52 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2435008..2435066 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PS042_RS12140	2430158..2430259	-	102	Protein_2374	protein YdfB	-
PS042_RS12145	2430261..2430416	-	156	WP_000379575.1	DUF1391 family protein	-
PS042_RS12150	2430609..2431016	-	408	WP_001003381.1	helix-turn-helix domain-containing protein	-
PS042_RS12155	2431094..2431321	+	228	WP_000476994.1	Cro/CI family transcriptional regulator	-
PS042_RS12160	2431305..2431826	+	522	WP_000705349.1	toxin YdaT family protein	-
PS042_RS12165	2431807..2432772	+	966	WP_001533283.1	hypothetical protein	-
PS042_RS12170	2432813..2433235	+	423	WP_001599153.1	DUF977 family protein	-
PS042_RS12175	2433652..2434617	+	966	WP_256903978.1	hypothetical protein	-
-	2435008..2435066	-	59	-	-	Antitoxin
PS042_RS12180	2435078..2435233	+	156	WP_000813254.1	type I toxin-antitoxin system toxin HokD	Toxin
PS042_RS12185	2435450..2435701	+	252	WP_001533277.1	protein Rem	-
PS042_RS12190	2435768..2436046	+	279	WP_012304870.1	hypothetical protein	-
PS042_RS12195	2436048..2437097	+	1050	WP_001533276.1	DUF968 domain-containing protein	-
PS042_RS12200	2437111..2437863	+	753	WP_001047139.1	antitermination protein	-
PS042_RS12205	2438141..2438230	-	90	WP_120795389.1	hypothetical protein	-
PS042_RS12210	2438285..2438497	-	213	WP_000087756.1	cold shock-like protein CspF	-
PS042_RS12215	2438798..2439013	+	216	WP_000066484.1	cold shock-like protein CspB	-
PS042_RS12220	2439376..2439546	-	171	WP_001405948.1	putative zinc-binding protein YnfU	-
PS042_RS12225	2439766..2439981	+	216	WP_000839590.1	phage lysis protein EssD	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	2412819..2470272	57453

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (6-47)

Sequences

Toxin

Protein

• Length: 52 a.a.
• Molecular weight: 5736.89 Da
• Isoelectric Point: 6.1531

>T271548 WP_000813254.1 NZ_CP117586:2435078-2435233 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Nucleotide

• Length: 156 bp

Antitoxin

Nucleotide

• Length: 59 bp

>AT271548 NZ_CP117586:c2435066-2435008 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTCTAGCATGAAATTGGCCTCA

Structures

Toxin

• AlphaFold DB: A0A4P7TMW0

Antitoxin