Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1047655..1047900 | Replicon | chromosome |
Accession | NZ_CP117586 | ||
Organism | Escherichia albertii strain BIA_40 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | PS042_RS05005 | Protein ID | WP_000956458.1 |
Coordinates | 1047748..1047900 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1047655..1047703 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS042_RS04990 | 1043059..1044858 | + | 1800 | WP_059241923.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
PS042_RS04995 | 1044858..1046570 | + | 1713 | WP_256875819.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS042_RS05000 | 1046750..1047484 | + | 735 | WP_059235904.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1047655..1047703 | - | 49 | - | - | Antitoxin |
PS042_RS05005 | 1047748..1047900 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
PS042_RS05010 | 1048025..1049062 | - | 1038 | WP_059235902.1 | alkaline phosphatase isozyme conversion aminopeptidase | - |
PS042_RS05015 | 1049316..1050224 | + | 909 | WP_000372392.1 | sulfate adenylyltransferase subunit CysD | - |
PS042_RS05020 | 1050226..1051653 | + | 1428 | WP_256875818.1 | sulfate adenylyltransferase subunit CysN | - |
PS042_RS05025 | 1051653..1052258 | + | 606 | WP_024164730.1 | adenylyl-sulfate kinase | - |
PS042_RS05030 | 1052308..1052631 | + | 324 | WP_001246114.1 | DUF3561 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271543 WP_000956458.1 NZ_CP117586:1047748-1047900 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271543 NZ_CP117586:c1047703-1047655 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|