Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 594333..595132 | Replicon | chromosome |
Accession | NZ_CP117586 | ||
Organism | Escherichia albertii strain BIA_40 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | PS042_RS02925 | Protein ID | WP_059235443.1 |
Coordinates | 594333..594797 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | PS042_RS02930 | Protein ID | WP_001296435.1 |
Coordinates | 594797..595132 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS042_RS02895 (589334) | 589334..589768 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
PS042_RS02900 (589786) | 589786..590664 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
PS042_RS02905 (590654) | 590654..591433 | - | 780 | WP_105175636.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
PS042_RS02910 (591444) | 591444..591917 | - | 474 | WP_059218168.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
PS042_RS02915 (591940) | 591940..593220 | - | 1281 | WP_059235447.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
PS042_RS02920 (593469) | 593469..594278 | + | 810 | WP_059235445.1 | aga operon transcriptional regulator AgaR | - |
PS042_RS02925 (594333) | 594333..594797 | - | 465 | WP_059235443.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
PS042_RS02930 (594797) | 594797..595132 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
PS042_RS02935 (595281) | 595281..596852 | - | 1572 | WP_059235441.1 | galactarate dehydratase | - |
PS042_RS02940 (597223) | 597223..598557 | + | 1335 | WP_059241781.1 | galactarate/glucarate/glycerate transporter GarP | - |
PS042_RS02945 (598573) | 598573..599343 | + | 771 | WP_059235438.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17825.22 Da Isoelectric Point: 9.6804
>T271540 WP_059235443.1 NZ_CP117586:c594797-594333 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSSAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSSAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|