Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 166890..167147 Replicon chromosome
Accession NZ_CP117586
Organism Escherichia albertii strain BIA_40

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS042_RS00760 Protein ID WP_001135738.1
Coordinates 166995..167147 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 166890..166938 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS042_RS00740 162120..163115 - 996 WP_059235567.1 acyltransferase -
PS042_RS00745 163288..163587 + 300 WP_000979961.1 YsaB family lipoprotein -
PS042_RS00750 163683..164594 + 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS042_RS00755 164604..166673 + 2070 WP_059235569.1 glycine--tRNA ligase subunit beta -
- 166890..166938 - 49 - - Antitoxin
PS042_RS00760 166995..167147 + 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
PS042_RS00765 167124..167195 - 72 WP_212734940.1 hypothetical protein -
PS042_RS00770 167335..167547 - 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS042_RS00775 167830..168120 - 291 WP_000455794.1 HTH-type transcriptional regulator -
PS042_RS00780 168543..169253 + 711 WP_002460072.1 DUF3053 domain-containing protein -
PS042_RS00785 169306..170280 - 975 WP_059235571.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS042_RS00790 170384..171043 - 660 WP_000747625.1 OmpA family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271538 WP_001135738.1 NZ_CP117586:166995-167147 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 49 bp

>AT271538 NZ_CP117586:c166938-166890 [Escherichia albertii]
GCATAGAGGGGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References