Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symE-OrzO/SymE(toxin) |
| Location | 3681004..3681416 | Replicon | chromosome |
| Accession | NZ_CP117583 | ||
| Organism | Escherichia albertii strain BIA_41 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | - |
| Locus tag | PS045_RS17845 | Protein ID | WP_256878708.1 |
| Coordinates | 3681004..3681345 (-) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | OrzO | ||
| Locus tag | - | ||
| Coordinates | 3681340..3681416 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS045_RS17825 (3677378) | 3677378..3678310 | + | 933 | WP_256878710.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| PS045_RS17830 (3678463) | 3678463..3678636 | - | 174 | Protein_3476 | GntR family transcriptional regulator | - |
| PS045_RS17835 (3678861) | 3678861..3679737 | + | 877 | Protein_3477 | DUF262 domain-containing protein | - |
| PS045_RS17840 (3679791) | 3679791..3680957 | + | 1167 | WP_256878709.1 | DUF1524 domain-containing protein | - |
| PS045_RS17845 (3681004) | 3681004..3681345 | - | 342 | WP_256878708.1 | endoribonuclease SymE | Toxin |
| - (3681340) | 3681340..3681416 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (3681340) | 3681340..3681416 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (3681340) | 3681340..3681416 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (3681340) | 3681340..3681416 | + | 77 | NuclAT_10 | - | Antitoxin |
| - (3681340) | 3681340..3681416 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (3681340) | 3681340..3681416 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (3681340) | 3681340..3681416 | + | 77 | NuclAT_9 | - | Antitoxin |
| - (3681340) | 3681340..3681416 | + | 77 | NuclAT_9 | - | Antitoxin |
| PS045_RS17850 (3681573) | 3681573..3682928 | - | 1356 | WP_256878707.1 | restriction endonuclease subunit S | - |
| PS045_RS17855 (3682925) | 3682925..3684514 | - | 1590 | WP_059250861.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12414.27 Da Isoelectric Point: 8.4921
>T271530 WP_256878708.1 NZ_CP117583:c3681345-3681004 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRKLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPATEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
MTDTHSIAQPFEAEVSPANNRKLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPATEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271530 NZ_CP117583:3681340-3681416 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|