Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2734107..2734364 | Replicon | chromosome |
Accession | NZ_CP117583 | ||
Organism | Escherichia albertii strain BIA_41 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | V0YDF1 |
Locus tag | PS045_RS13325 | Protein ID | WP_001135738.1 |
Coordinates | 2734107..2734259 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 2734310..2734364 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS045_RS13295 | 2729493..2730152 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
PS045_RS13300 | 2730256..2731230 | + | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
PS045_RS13305 | 2731283..2731993 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
PS045_RS13310 | 2732416..2732706 | + | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
PS045_RS13315 | 2732989..2733201 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
PS045_RS13320 | 2733269..2733955 | - | 687 | WP_059271833.1 | hypothetical protein | - |
PS045_RS13325 | 2734107..2734259 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
- | 2734310..2734364 | + | 55 | - | - | Antitoxin |
PS045_RS13330 | 2734580..2736649 | - | 2070 | WP_059221279.1 | glycine--tRNA ligase subunit beta | - |
PS045_RS13335 | 2736659..2737570 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
PS045_RS13340 | 2737666..2737965 | - | 300 | WP_059229187.1 | YsaB family lipoprotein | - |
PS045_RS13345 | 2738138..2739133 | + | 996 | WP_256879259.1 | acyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T271528 WP_001135738.1 NZ_CP117583:c2734259-2734107 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT271528 NZ_CP117583:2734310-2734364 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|