Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 2651673..2652373 | Replicon | chromosome |
Accession | NZ_CP117583 | ||
Organism | Escherichia albertii strain BIA_41 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PS045_RS12965 | Protein ID | WP_256879206.1 |
Coordinates | 2651673..2651963 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS045_RS12970 | Protein ID | WP_000806446.1 |
Coordinates | 2652035..2652373 (+) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS045_RS12940 (2648323) | 2648323..2649165 | + | 843 | WP_010326142.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
PS045_RS12945 (2649237) | 2649237..2650589 | + | 1353 | WP_054410173.1 | glutathione-disulfide reductase | - |
PS045_RS12950 (2650643) | 2650643..2650726 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
PS045_RS12955 (2650754) | 2650754..2650927 | + | 174 | WP_000553433.1 | hypothetical protein | - |
PS045_RS12960 (2651017) | 2651017..2651496 | - | 480 | WP_059215194.1 | hypothetical protein | - |
PS045_RS12965 (2651673) | 2651673..2651963 | + | 291 | WP_256879206.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS045_RS12970 (2652035) | 2652035..2652373 | + | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
PS045_RS12975 (2652464) | 2652464..2652613 | + | 150 | WP_233991781.1 | hypothetical protein | - |
PS045_RS12980 (2652960) | 2652960..2653526 | + | 567 | WP_059216822.1 | outer membrane lipoprotein Slp | - |
PS045_RS12985 (2653673) | 2653673..2654203 | + | 531 | WP_256879204.1 | LuxR C-terminal-related transcriptional regulator | - |
PS045_RS12990 (2654275) | 2654275..2655303 | - | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
PS045_RS12995 (2655352) | 2655352..2657334 | - | 1983 | WP_059251954.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11429.03 Da Isoelectric Point: 8.8483
>T271527 WP_256879206.1 NZ_CP117583:2651673-2651963 [Escherichia albertii]
INIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNCYSSIRVNNQYRLIFK
WVNGKAEDLYLDPHKY
INIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNCYSSIRVNNQYRLIFK
WVNGKAEDLYLDPHKY
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|