Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2296756..2297555 | Replicon | chromosome |
| Accession | NZ_CP117583 | ||
| Organism | Escherichia albertii strain BIA_41 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A8H9C2I0 |
| Locus tag | PS045_RS11100 | Protein ID | WP_059227548.1 |
| Coordinates | 2297091..2297555 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | PS045_RS11095 | Protein ID | WP_001296435.1 |
| Coordinates | 2296756..2297091 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS045_RS11080 (2292545) | 2292545..2293315 | - | 771 | WP_025238278.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| PS045_RS11085 (2293331) | 2293331..2294665 | - | 1335 | WP_025238277.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PS045_RS11090 (2295036) | 2295036..2296607 | + | 1572 | WP_256878808.1 | galactarate dehydratase | - |
| PS045_RS11095 (2296756) | 2296756..2297091 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PS045_RS11100 (2297091) | 2297091..2297555 | + | 465 | WP_059227548.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PS045_RS11105 (2297610) | 2297610..2298419 | - | 810 | WP_000072169.1 | aga operon transcriptional regulator AgaR | - |
| PS045_RS11110 (2298668) | 2298668..2299948 | + | 1281 | WP_256878807.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PS045_RS11115 (2299971) | 2299971..2300444 | + | 474 | WP_002461030.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PS045_RS11120 (2300455) | 2300455..2301234 | + | 780 | WP_000406226.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PS045_RS11125 (2301224) | 2301224..2302102 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PS045_RS11130 (2302120) | 2302120..2302554 | + | 435 | WP_149451364.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17819.26 Da Isoelectric Point: 9.7301
>T271525 WP_059227548.1 NZ_CP117583:2297091-2297555 [Escherichia albertii]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRFRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTQETEEKH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|