Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2255302..2256029 | Replicon | chromosome |
| Accession | NZ_CP117583 | ||
| Organism | Escherichia albertii strain BIA_41 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | PS045_RS10900 | Protein ID | WP_000550189.1 |
| Coordinates | 2255715..2256029 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS045_RS10895 | Protein ID | WP_256878813.1 |
| Coordinates | 2255302..2255718 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS045_RS10885 (2250395) | 2250395..2252746 | + | 2352 | WP_000695424.1 | alpha-glucosidase | - |
| PS045_RS10890 (2253194) | 2253194..2255212 | + | 2019 | WP_256878814.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| PS045_RS10895 (2255302) | 2255302..2255718 | - | 417 | WP_256878813.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| PS045_RS10900 (2255715) | 2255715..2256029 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| PS045_RS10905 (2256312) | 2256312..2257448 | - | 1137 | WP_060877474.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| PS045_RS10910 (2257533) | 2257533..2258036 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| PS045_RS10915 (2258113) | 2258113..2258805 | + | 693 | WP_000942533.1 | vancomycin high temperature exclusion protein | - |
| PS045_RS10920 (2258884) | 2258884..2259870 | + | 987 | WP_000617693.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T271524 WP_000550189.1 NZ_CP117583:c2256029-2255715 [Escherichia albertii]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14983.36 Da Isoelectric Point: 4.3697
>AT271524 WP_256878813.1 NZ_CP117583:c2255718-2255302 [Escherichia albertii]
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMSGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
MIAIADILQAGEKLTDVAPFLAGIQSEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMVQAMSGG
VAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLNGKRKLTLEHAKKLAARFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|