Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1854188..1854433 | Replicon | chromosome |
| Accession | NZ_CP117583 | ||
| Organism | Escherichia albertii strain BIA_41 | ||
Toxin (Protein)
| Gene name | hokX | Uniprot ID | L4J2K8 |
| Locus tag | PS045_RS09075 | Protein ID | WP_000956460.1 |
| Coordinates | 1854188..1854340 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 1854385..1854433 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS045_RS09050 | 1849456..1849779 | - | 324 | WP_001246114.1 | DUF3561 family protein | - |
| PS045_RS09055 | 1849829..1850434 | - | 606 | WP_256878896.1 | adenylyl-sulfate kinase | - |
| PS045_RS09060 | 1850434..1851861 | - | 1428 | WP_054412002.1 | sulfate adenylyltransferase subunit CysN | - |
| PS045_RS09065 | 1851863..1852771 | - | 909 | WP_000372392.1 | sulfate adenylyltransferase subunit CysD | - |
| PS045_RS09070 | 1853025..1854062 | + | 1038 | WP_256878880.1 | alkaline phosphatase isozyme conversion aminopeptidase | - |
| PS045_RS09075 | 1854188..1854340 | - | 153 | WP_000956460.1 | Hok/Gef family protein | Toxin |
| - | 1854385..1854433 | + | 49 | - | - | Antitoxin |
| PS045_RS09080 | 1854604..1855338 | - | 735 | WP_059216810.1 | phosphoadenosine phosphosulfate reductase | - |
| PS045_RS09085 | 1855518..1857230 | - | 1713 | WP_273774864.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
| PS045_RS09090 | 1857230..1859029 | - | 1800 | WP_256878879.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5602.81 Da Isoelectric Point: 7.7899
>T271522 WP_000956460.1 NZ_CP117583:c1854340-1854188 [Escherichia albertii]
MLTKYALVAIIVLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCFTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 49 bp
>AT271522 NZ_CP117583:1854385-1854433 [Escherichia albertii]
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
GTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|