Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-sib/SymE(toxin) |
Location | 3877083..3877495 | Replicon | chromosome |
Accession | NZ_CP117580 | ||
Organism | Escherichia albertii strain BIA_47 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A7U8ZC55 |
Locus tag | PS044_RS18910 | Protein ID | WP_025237738.1 |
Coordinates | 3877154..3877495 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | sib | ||
Locus tag | - | ||
Coordinates | 3877083..3877159 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS044_RS18900 (3873978) | 3873978..3875567 | + | 1590 | WP_273807938.1 | type I restriction-modification system methyltransferase | - |
PS044_RS18905 (3875564) | 3875564..3876926 | + | 1363 | Protein_3693 | restriction endonuclease subunit S | - |
- (3877083) | 3877083..3877159 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3877083) | 3877083..3877159 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3877083) | 3877083..3877159 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3877083) | 3877083..3877159 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3877083) | 3877083..3877159 | - | 77 | NuclAT_8 | - | Antitoxin |
- (3877083) | 3877083..3877159 | - | 77 | NuclAT_8 | - | Antitoxin |
- (3877083) | 3877083..3877159 | - | 77 | NuclAT_8 | - | Antitoxin |
- (3877083) | 3877083..3877159 | - | 77 | NuclAT_8 | - | Antitoxin |
PS044_RS18910 (3877154) | 3877154..3877495 | + | 342 | WP_025237738.1 | endoribonuclease SymE | Toxin |
PS044_RS18915 (3877542) | 3877542..3878708 | - | 1167 | WP_077696034.1 | DUF1524 domain-containing protein | - |
PS044_RS18920 (3878747) | 3878747..3879638 | - | 892 | Protein_3696 | DUF262 domain-containing protein | - |
PS044_RS18925 (3879863) | 3879863..3880036 | + | 174 | Protein_3697 | GntR family transcriptional regulator | - |
PS044_RS18930 (3880188) | 3880188..3881119 | - | 932 | Protein_3698 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3876570..3887413 | 10843 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12310.12 Da Isoelectric Point: 7.8219
>T271508 WP_025237738.1 NZ_CP117580:3877154-3877495 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAIDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAIDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271508 NZ_CP117580:c3877159-3877083 [Escherichia albertii]
AGTCATGATTACTATTCTCCATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATGATTACTATTCTCCATAAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|