Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3775851..3776109 | Replicon | chromosome |
Accession | NZ_CP117580 | ||
Organism | Escherichia albertii strain BIA_47 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | PS044_RS18400 | Protein ID | WP_000809168.1 |
Coordinates | 3775957..3776109 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3775851..3775908 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS044_RS18385 | 3771801..3773048 | - | 1248 | WP_025237694.1 | hypothetical protein | - |
PS044_RS18390 | 3773202..3774552 | - | 1351 | Protein_3593 | sulfatase-like hydrolase/transferase | - |
PS044_RS18395 | 3774573..3775334 | - | 762 | WP_001276206.1 | outer membrane protein OmpK | - |
- | 3775851..3775908 | - | 58 | - | - | Antitoxin |
PS044_RS18400 | 3775957..3776109 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
PS044_RS18405 | 3776218..3777348 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
PS044_RS18410 | 3777437..3779353 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
PS044_RS18415 | 3779728..3780132 | + | 405 | WP_000833521.1 | DUF2541 family protein | - |
PS044_RS18420 | 3780159..3780872 | + | 714 | WP_001102345.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271507 WP_000809168.1 NZ_CP117580:3775957-3776109 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271507 NZ_CP117580:c3775908-3775851 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|