Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1131325..1132052 | Replicon | chromosome |
| Accession | NZ_CP117580 | ||
| Organism | Escherichia albertii strain BIA_47 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | PS044_RS05465 | Protein ID | WP_000547563.1 |
| Coordinates | 1131325..1131636 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS044_RS05470 | Protein ID | WP_000126297.1 |
| Coordinates | 1131633..1132052 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS044_RS05435 (1126467) | 1126467..1128176 | + | 1710 | WP_025238503.1 | formate hydrogenlyase subunit HycE | - |
| PS044_RS05440 (1128186) | 1128186..1128728 | + | 543 | WP_000493797.1 | formate hydrogenlyase subunit HycF | - |
| PS044_RS05445 (1128728) | 1128728..1129495 | + | 768 | WP_025238504.1 | formate hydrogenlyase subunit HycG | - |
| PS044_RS05450 (1129492) | 1129492..1129902 | + | 411 | WP_001291913.1 | formate hydrogenlyase assembly protein HycH | - |
| PS044_RS05455 (1129895) | 1129895..1130365 | + | 471 | WP_000132954.1 | hydrogenase maturation peptidase HycI | - |
| PS044_RS05460 (1130408) | 1130408..1131163 | + | 756 | WP_025238505.1 | hypothetical protein | - |
| PS044_RS05465 (1131325) | 1131325..1131636 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PS044_RS05470 (1131633) | 1131633..1132052 | + | 420 | WP_000126297.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PS044_RS05475 (1132144) | 1132144..1132572 | - | 429 | WP_000536065.1 | DUF4259 domain-containing protein | - |
| PS044_RS05480 (1132995) | 1132995..1133522 | + | 528 | WP_273808284.1 | electron transport protein HydN | - |
| PS044_RS05485 (1133675) | 1133675..1135927 | + | 2253 | WP_025238507.1 | carbamoyltransferase HypF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T271499 WP_000547563.1 NZ_CP117580:1131325-1131636 [Escherichia albertii]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15446.45 Da Isoelectric Point: 4.4596
>AT271499 WP_000126297.1 NZ_CP117580:1131633-1132052 [Escherichia albertii]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLTSRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|