Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1091396..1091642 | Replicon | chromosome |
Accession | NZ_CP117580 | ||
Organism | Escherichia albertii strain BIA_47 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | PS044_RS05245 | Protein ID | WP_000956458.1 |
Coordinates | 1091490..1091642 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1091396..1091448 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS044_RS05230 | 1086800..1088599 | + | 1800 | WP_273808277.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
PS044_RS05235 | 1088599..1090311 | + | 1713 | WP_208629640.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS044_RS05240 | 1090491..1091225 | + | 735 | WP_025238482.1 | phosphoadenosine phosphosulfate reductase | - |
- | 1091396..1091448 | - | 53 | - | - | Antitoxin |
PS044_RS05245 | 1091490..1091642 | + | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
PS044_RS05250 | 1091768..1092805 | - | 1038 | WP_059225076.1 | alkaline phosphatase isozyme conversion aminopeptidase | - |
PS044_RS05255 | 1093058..1093966 | + | 909 | WP_000372392.1 | sulfate adenylyltransferase subunit CysD | - |
PS044_RS05260 | 1093968..1095395 | + | 1428 | WP_273808279.1 | sulfate adenylyltransferase subunit CysN | - |
PS044_RS05265 | 1095395..1096000 | + | 606 | WP_024164730.1 | adenylyl-sulfate kinase | - |
PS044_RS05270 | 1096050..1096373 | + | 324 | WP_001246114.1 | DUF3561 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271498 WP_000956458.1 NZ_CP117580:1091490-1091642 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT271498 NZ_CP117580:c1091448-1091396 [Escherichia albertii]
TTAGGTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGTAGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|