Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 270592..271304 | Replicon | chromosome |
Accession | NZ_CP117580 | ||
Organism | Escherichia albertii strain BIA_47 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7U8WCQ7 |
Locus tag | PS044_RS01245 | Protein ID | WP_000162413.1 |
Coordinates | 271002..271304 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PS044_RS01240 | Protein ID | WP_000806446.1 |
Coordinates | 270592..270930 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS044_RS01215 (265633) | 265633..267614 | + | 1982 | Protein_239 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
PS044_RS01220 (267663) | 267663..268691 | + | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
PS044_RS01225 (268763) | 268763..269293 | - | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
PS044_RS01230 (269440) | 269440..270006 | - | 567 | WP_001044206.1 | outer membrane lipoprotein Slp | - |
PS044_RS01235 (270368) | 270368..270535 | - | 168 | WP_232529606.1 | hypothetical protein | - |
PS044_RS01240 (270592) | 270592..270930 | - | 339 | WP_000806446.1 | HigA family addiction module antitoxin | Antitoxin |
PS044_RS01245 (271002) | 271002..271304 | - | 303 | WP_000162413.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PS044_RS01250 (271468) | 271468..271947 | + | 480 | WP_025238141.1 | hypothetical protein | - |
PS044_RS01255 (272037) | 272037..272210 | - | 174 | WP_000553433.1 | hypothetical protein | - |
PS044_RS01260 (272238) | 272238..272321 | + | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
PS044_RS01265 (272375) | 272375..273727 | - | 1353 | WP_256876822.1 | glutathione-disulfide reductase | - |
PS044_RS01270 (273799) | 273799..274641 | - | 843 | WP_025238143.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11871.59 Da Isoelectric Point: 9.8664
>T271495 WP_000162413.1 NZ_CP117580:c271304-271002 [Escherichia albertii]
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKDFRDAWLDDFFEFSTPHKKIPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|