Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2763022..2763279 Replicon chromosome
Accession NZ_CP117575
Organism Escherichia albertii strain BIA_5

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS037_RS13450 Protein ID WP_001135738.1
Coordinates 2763022..2763174 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 2763225..2763279 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS037_RS13420 2759126..2759785 + 660 WP_000747625.1 OmpA family lipoprotein -
PS037_RS13425 2759889..2760863 + 975 WP_125317713.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS037_RS13430 2760916..2761626 - 711 WP_002460072.1 DUF3053 domain-containing protein -
PS037_RS13435 2762049..2762339 + 291 WP_000455794.1 HTH-type transcriptional regulator -
PS037_RS13440 2762622..2762834 + 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS037_RS13445 2762974..2763045 + 72 WP_212743705.1 hypothetical protein -
PS037_RS13450 2763022..2763174 - 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
- 2763225..2763279 + 55 - - Antitoxin
PS037_RS13455 2763497..2765566 - 2070 WP_001291807.1 glycine--tRNA ligase subunit beta -
PS037_RS13460 2765576..2766487 - 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS037_RS13465 2766583..2766882 - 300 WP_000979961.1 YsaB family lipoprotein -
PS037_RS13470 2767055..2768050 + 996 WP_001182625.1 acyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271483 WP_001135738.1 NZ_CP117575:c2763174-2763022 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT271483 NZ_CP117575:2763225-2763279 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References