Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2763022..2763279 | Replicon | chromosome |
| Accession | NZ_CP117575 | ||
| Organism | Escherichia albertii strain BIA_5 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | PS037_RS13450 | Protein ID | WP_001135738.1 |
| Coordinates | 2763022..2763174 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 2763225..2763279 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS037_RS13420 | 2759126..2759785 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
| PS037_RS13425 | 2759889..2760863 | + | 975 | WP_125317713.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| PS037_RS13430 | 2760916..2761626 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| PS037_RS13435 | 2762049..2762339 | + | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
| PS037_RS13440 | 2762622..2762834 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| PS037_RS13445 | 2762974..2763045 | + | 72 | WP_212743705.1 | hypothetical protein | - |
| PS037_RS13450 | 2763022..2763174 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 2763225..2763279 | + | 55 | - | - | Antitoxin |
| PS037_RS13455 | 2763497..2765566 | - | 2070 | WP_001291807.1 | glycine--tRNA ligase subunit beta | - |
| PS037_RS13460 | 2765576..2766487 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| PS037_RS13465 | 2766583..2766882 | - | 300 | WP_000979961.1 | YsaB family lipoprotein | - |
| PS037_RS13470 | 2767055..2768050 | + | 996 | WP_001182625.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T271483 WP_001135738.1 NZ_CP117575:c2763174-2763022 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT271483 NZ_CP117575:2763225-2763279 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|