Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 2687248..2687960 | Replicon | chromosome |
| Accession | NZ_CP117575 | ||
| Organism | Escherichia albertii strain BIA_5 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PS037_RS13115 | Protein ID | WP_273821100.1 |
| Coordinates | 2687248..2687550 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PS037_RS13120 | Protein ID | WP_000806447.1 |
| Coordinates | 2687622..2687960 (+) | Length | 113 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS037_RS13090 (2683911) | 2683911..2684753 | + | 843 | WP_000954227.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase | - |
| PS037_RS13095 (2684825) | 2684825..2686177 | + | 1353 | WP_000160823.1 | glutathione-disulfide reductase | - |
| PS037_RS13100 (2686231) | 2686231..2686314 | - | 84 | WP_001295215.1 | damage-inducible type I toxin DinQ | - |
| PS037_RS13105 (2686342) | 2686342..2686515 | + | 174 | WP_273821098.1 | hypothetical protein | - |
| PS037_RS13110 (2686605) | 2686605..2687084 | - | 480 | WP_273821099.1 | hypothetical protein | - |
| PS037_RS13115 (2687248) | 2687248..2687550 | + | 303 | WP_273821100.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PS037_RS13120 (2687622) | 2687622..2687960 | + | 339 | WP_000806447.1 | HigA family addiction module antitoxin | Antitoxin |
| PS037_RS13125 (2688017) | 2688017..2688184 | + | 168 | WP_232529606.1 | hypothetical protein | - |
| PS037_RS13130 (2688546) | 2688546..2689112 | + | 567 | WP_273821101.1 | outer membrane lipoprotein Slp | - |
| PS037_RS13135 (2689259) | 2689259..2689789 | + | 531 | WP_000480294.1 | LuxR C-terminal-related transcriptional regulator | - |
| PS037_RS13140 (2689861) | 2689861..2690889 | - | 1029 | WP_001110408.1 | hematinate-forming heme oxygenase ChuS | - |
| PS037_RS13145 (2690938) | 2690938..2692920 | - | 1983 | WP_000089601.1 | TonB-dependent heme/hemoglobin receptor ChuA/ShuA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11888.63 Da Isoelectric Point: 10.0443
>T271482 WP_273821100.1 NZ_CP117575:2687248-2687550 [Escherichia albertii]
MTKKINIKNFRDAWLDDFFEFSTPHKKMPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
MTKKINIKNFRDAWLDDFFEFSTPHKKMPSDIHITLLRKLDIINAATTWKDLRSPPGNRYEELSGKLNGYSSIRVNNQYR
LIFKWVNGKAEDLYLDPHKY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|