Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1885364..1885610 | Replicon | chromosome |
Accession | NZ_CP117575 | ||
Organism | Escherichia albertii strain BIA_5 |
Toxin (Protein)
Gene name | hokX | Uniprot ID | S1PD89 |
Locus tag | PS037_RS09190 | Protein ID | WP_000956458.1 |
Coordinates | 1885364..1885516 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 1885558..1885610 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS037_RS09180 | 1881149..1883806 | - | 2658 | WP_273821801.1 | CRISPR-associated helicase Cas3' | - |
PS037_RS09185 | 1884059..1885171 | + | 1113 | WP_085456548.1 | IS4 family transposase | - |
PS037_RS09190 | 1885364..1885516 | - | 153 | WP_000956458.1 | Hok/Gef family protein | Toxin |
- | 1885558..1885610 | + | 53 | - | - | Antitoxin |
PS037_RS09195 | 1885781..1886515 | - | 735 | WP_001125130.1 | phosphoadenosine phosphosulfate reductase | - |
PS037_RS09200 | 1886600..1888312 | - | 1713 | WP_273821802.1 | assimilatory sulfite reductase (NADPH) hemoprotein subunit | - |
PS037_RS09205 | 1888312..1890111 | - | 1800 | WP_273821803.1 | NADPH-dependent assimilatory sulfite reductase flavoprotein subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5558.77 Da Isoelectric Point: 7.6757
>T271478 WP_000956458.1 NZ_CP117575:c1885516-1885364 [Escherichia albertii]
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
MLTKYALVAIIVLCCTVLGFTLMVGDSLCELSIRERGMEFKAVLAYESKK
Download Length: 153 bp
Antitoxin
Download Length: 53 bp
>AT271478 NZ_CP117575:1885558-1885610 [Escherichia albertii]
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
TTAGGTTCGAACGCTGGCCTCAGGTTGATAGAAATATCGCCTGGGGCTTTTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|