Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1088923..1089148 Replicon chromosome
Accession NZ_CP117575
Organism Escherichia albertii strain BIA_5

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag PS037_RS05450 Protein ID WP_000813254.1
Coordinates 1088923..1089078 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1089090..1089148 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS037_RS05420 1085592..1086134 - 543 WP_105198694.1 DUF1133 family protein -
PS037_RS05425 1086131..1086421 - 291 WP_089638331.1 DUF1364 domain-containing protein -
PS037_RS05430 1086421..1087020 - 600 WP_273821684.1 DUF1367 family protein -
PS037_RS05435 1087080..1087304 - 225 WP_273821685.1 hypothetical protein -
PS037_RS05440 1087835..1088317 - 483 WP_137494095.1 ImmA/IrrE family metallo-endopeptidase -
PS037_RS05445 1088334..1088687 - 354 WP_137494094.1 helix-turn-helix transcriptional regulator -
PS037_RS05450 1088923..1089078 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 1089090..1089148 + 59 - - Antitoxin
PS037_RS05455 1089364..1090248 + 885 WP_273821686.1 hypothetical protein -
PS037_RS05460 1090236..1090697 + 462 WP_089624648.1 hypothetical protein -
PS037_RS05465 1090868..1091224 - 357 WP_000403783.1 hypothetical protein -
PS037_RS05470 1091282..1091698 - 417 WP_273821687.1 DUF977 family protein -
PS037_RS05475 1091706..1092467 - 762 WP_273821688.1 DUF1627 domain-containing protein -
PS037_RS05480 1092490..1093236 - 747 WP_048969775.1 ATP-binding protein -
PS037_RS05485 1093243..1094055 - 813 WP_273821689.1 DUF1376 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1049736..1104386 54650


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T271476 WP_000813254.1 NZ_CP117575:c1089078-1088923 [Escherichia albertii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT271476 NZ_CP117575:1089090-1089148 [Escherichia albertii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References