Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 54313..54567 | Replicon | plasmid pEA50_1 |
| Accession | NZ_CP117571 | ||
| Organism | Escherichia albertii strain BIA_50 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PS035_RS23080 | Protein ID | WP_001312851.1 |
| Coordinates | 54313..54462 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 54506..54567 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS035_RS23040 (50522) | 50522..50821 | - | 300 | WP_000119542.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PS035_RS23045 (50811) | 50811..51074 | - | 264 | WP_001089474.1 | hypothetical protein | - |
| PS035_RS23050 (51094) | 51094..51231 | - | 138 | Protein_54 | XRE family transcriptional regulator | - |
| PS035_RS23055 (52141) | 52141..52998 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PS035_RS23060 (52991) | 52991..53473 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| PS035_RS23065 (53466) | 53466..53513 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| PS035_RS23070 (53504) | 53504..53755 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| PS035_RS23075 (53772) | 53772..54029 | - | 258 | WP_258141648.1 | replication regulatory protein RepA | - |
| PS035_RS23080 (54313) | 54313..54462 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (54506) | 54506..54567 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (54506) | 54506..54567 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (54506) | 54506..54567 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (54506) | 54506..54567 | + | 62 | NuclAT_1 | - | Antitoxin |
| PS035_RS23085 (54823) | 54823..54897 | - | 75 | Protein_61 | endonuclease | - |
| PS035_RS23090 (55143) | 55143..55355 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PS035_RS23095 (55491) | 55491..56051 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PS035_RS23100 (56154) | 56154..57014 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| PS035_RS23105 (57073) | 57073..57819 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iutA / iucD / iucC / iucB / iucA / espK / paa / vat | 1..165614 | 165614 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T271464 WP_001312851.1 NZ_CP117571:c54462-54313 [Escherichia albertii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT271464 NZ_CP117571:54506-54567 [Escherichia albertii]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
