Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 3968343..3968755 | Replicon | chromosome |
Accession | NZ_CP117570 | ||
Organism | Escherichia albertii strain BIA_50 |
Toxin (Protein)
Gene name | symE | Uniprot ID | A0A8D9PK47 |
Locus tag | PS035_RS19145 | Protein ID | WP_000132619.1 |
Coordinates | 3968414..3968755 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 3968343..3968419 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS035_RS19135 (3965244) | 3965244..3966833 | + | 1590 | WP_157704341.1 | type I restriction-modification system methyltransferase | - |
PS035_RS19140 (3966830) | 3966830..3968185 | + | 1356 | WP_161537581.1 | restriction endonuclease subunit S | - |
- (3968343) | 3968343..3968419 | - | 77 | NuclAT_6 | - | Antitoxin |
- (3968343) | 3968343..3968419 | - | 77 | NuclAT_6 | - | Antitoxin |
- (3968343) | 3968343..3968419 | - | 77 | NuclAT_6 | - | Antitoxin |
- (3968343) | 3968343..3968419 | - | 77 | NuclAT_6 | - | Antitoxin |
- (3968343) | 3968343..3968419 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3968343) | 3968343..3968419 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3968343) | 3968343..3968419 | - | 77 | NuclAT_7 | - | Antitoxin |
- (3968343) | 3968343..3968419 | - | 77 | NuclAT_7 | - | Antitoxin |
PS035_RS19145 (3968414) | 3968414..3968755 | + | 342 | WP_000132619.1 | endoribonuclease SymE | Toxin |
PS035_RS19150 (3968917) | 3968917..3970296 | + | 1380 | WP_059217670.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
PS035_RS19155 (3970296) | 3970296..3971342 | + | 1047 | WP_273817450.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
PS035_RS19160 (3971398) | 3971398..3972476 | - | 1079 | Protein_3748 | DUF1998 domain-containing protein | - |
PS035_RS19165 (3972793) | 3972793..3973724 | - | 932 | Protein_3749 | Rpn family recombination-promoting nuclease/putative transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12322.13 Da Isoelectric Point: 7.8219
>T271459 WP_000132619.1 NZ_CP117570:3968414-3968755 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAPEESE
LMQSLRQVCKLSARKQKQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271459 NZ_CP117570:c3968419-3968343 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|