Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3891415..3891673 | Replicon | chromosome |
| Accession | NZ_CP117570 | ||
| Organism | Escherichia albertii strain BIA_50 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PS035_RS18775 | Protein ID | WP_000809168.1 |
| Coordinates | 3891521..3891673 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3891415..3891472 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS035_RS18760 | 3887222..3888469 | - | 1248 | WP_059227922.1 | hypothetical protein | - |
| PS035_RS18765 | 3888623..3890116 | - | 1494 | WP_059216552.1 | sulfatase-like hydrolase/transferase | - |
| PS035_RS18770 | 3890137..3890898 | - | 762 | WP_059216553.1 | outer membrane protein OmpK | - |
| - | 3891415..3891472 | - | 58 | - | - | Antitoxin |
| PS035_RS18775 | 3891521..3891673 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| PS035_RS18780 | 3891777..3892907 | - | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
| PS035_RS18785 | 3892996..3894912 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| PS035_RS18790 | 3895287..3895691 | + | 405 | WP_000833521.1 | DUF2541 family protein | - |
| PS035_RS18795 | 3895718..3896431 | + | 714 | WP_001102345.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271458 WP_000809168.1 NZ_CP117570:3891521-3891673 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271458 NZ_CP117570:c3891472-3891415 [Escherichia albertii]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|