Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3758244..3758502 | Replicon | chromosome |
Accession | NZ_CP117568 | ||
Organism | Escherichia albertii strain BIA_5-2 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | PS053_RS18220 | Protein ID | WP_000809168.1 |
Coordinates | 3758244..3758396 (-) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3758445..3758502 (+) |
Genomic Context
Location: 3755001..3756917 (1917 bp)
Type: Others
Protein ID: WP_000516135.1
Type: Others
Protein ID: WP_000516135.1
Location: 3757006..3758136 (1131 bp)
Type: Others
Protein ID: WP_001118445.1
Type: Others
Protein ID: WP_001118445.1
Location: 3758445..3758502 (58 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 3759018..3759779 (762 bp)
Type: Others
Protein ID: WP_105198098.1
Type: Others
Protein ID: WP_105198098.1
Location: 3759800..3761293 (1494 bp)
Type: Others
Protein ID: WP_059214855.1
Type: Others
Protein ID: WP_059214855.1
Location: 3761447..3762694 (1248 bp)
Type: Others
Protein ID: WP_059224806.1
Type: Others
Protein ID: WP_059224806.1
Location: 3753482..3754195 (714 bp)
Type: Others
Protein ID: WP_001102345.1
Type: Others
Protein ID: WP_001102345.1
Location: 3754222..3754626 (405 bp)
Type: Others
Protein ID: WP_000833521.1
Type: Others
Protein ID: WP_000833521.1
Location: 3758244..3758396 (153 bp)
Type: Toxin
Protein ID: WP_000809168.1
Type: Toxin
Protein ID: WP_000809168.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS053_RS18200 | 3753482..3754195 | - | 714 | WP_001102345.1 | acidic protein MsyB | - |
PS053_RS18205 | 3754222..3754626 | - | 405 | WP_000833521.1 | DUF2541 family protein | - |
PS053_RS18210 | 3755001..3756917 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
PS053_RS18215 | 3757006..3758136 | + | 1131 | WP_001118445.1 | molecular chaperone DnaJ | - |
PS053_RS18220 | 3758244..3758396 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
- | 3758445..3758502 | + | 58 | - | - | Antitoxin |
PS053_RS18225 | 3759018..3759779 | + | 762 | WP_105198098.1 | outer membrane protein OmpK | - |
PS053_RS18230 | 3759800..3761293 | + | 1494 | WP_059214855.1 | sulfatase-like hydrolase/transferase | - |
PS053_RS18235 | 3761447..3762694 | + | 1248 | WP_059224806.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T271444 WP_000809168.1 NZ_CP117568:c3758396-3758244 [Escherichia albertii]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT271444 NZ_CP117568:3758445-3758502 [Escherichia albertii]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NX00 |