Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-OrzO/SymE(toxin) |
Location | 3683450..3683862 | Replicon | chromosome |
Accession | NZ_CP117568 | ||
Organism | Escherichia albertii strain BIA_5-2 |
Toxin (Protein)
Gene name | symE | Uniprot ID | - |
Locus tag | PS053_RS17860 | Protein ID | WP_256878708.1 |
Coordinates | 3683450..3683791 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | OrzO | ||
Locus tag | - | ||
Coordinates | 3683786..3683862 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS053_RS17840 (3679824) | 3679824..3680756 | + | 933 | WP_256878710.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
PS053_RS17845 (3680909) | 3680909..3681082 | - | 174 | Protein_3479 | GntR family transcriptional regulator | - |
PS053_RS17850 (3681307) | 3681307..3682183 | + | 877 | Protein_3480 | DUF262 domain-containing protein | - |
PS053_RS17855 (3682237) | 3682237..3683403 | + | 1167 | WP_256878709.1 | DUF1524 domain-containing protein | - |
PS053_RS17860 (3683450) | 3683450..3683791 | - | 342 | WP_256878708.1 | endoribonuclease SymE | Toxin |
- (3683786) | 3683786..3683862 | + | 77 | NuclAT_10 | - | Antitoxin |
- (3683786) | 3683786..3683862 | + | 77 | NuclAT_10 | - | Antitoxin |
- (3683786) | 3683786..3683862 | + | 77 | NuclAT_10 | - | Antitoxin |
- (3683786) | 3683786..3683862 | + | 77 | NuclAT_10 | - | Antitoxin |
- (3683786) | 3683786..3683862 | + | 77 | NuclAT_9 | - | Antitoxin |
- (3683786) | 3683786..3683862 | + | 77 | NuclAT_9 | - | Antitoxin |
- (3683786) | 3683786..3683862 | + | 77 | NuclAT_9 | - | Antitoxin |
- (3683786) | 3683786..3683862 | + | 77 | NuclAT_9 | - | Antitoxin |
PS053_RS17865 (3684019) | 3684019..3685374 | - | 1356 | WP_256878707.1 | restriction endonuclease subunit S | - |
PS053_RS17870 (3685371) | 3685371..3686960 | - | 1590 | WP_059250861.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12414.27 Da Isoelectric Point: 8.4921
>T271440 WP_256878708.1 NZ_CP117568:c3683791-3683450 [Escherichia albertii]
MTDTHSIAQPFEAEVSPANNRKLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPATEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
MTDTHSIAQPFEAEVSPANNRKLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTTQPPATEESE
LMQSLRQVCKLSARKQKQVQEFIGVITGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT271440 NZ_CP117568:3683786-3683862 [Escherichia albertii]
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCGATAATAGTGATTGTGATGAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|