Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2736553..2736810 | Replicon | chromosome |
| Accession | NZ_CP117568 | ||
| Organism | Escherichia albertii strain BIA_5-2 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | V0YDF1 |
| Locus tag | PS053_RS13340 | Protein ID | WP_001135738.1 |
| Coordinates | 2736553..2736705 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 2736756..2736810 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS053_RS13310 | 2731939..2732598 | + | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
| PS053_RS13315 | 2732702..2733676 | + | 975 | WP_000804993.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| PS053_RS13320 | 2733729..2734439 | - | 711 | WP_002460072.1 | DUF3053 domain-containing protein | - |
| PS053_RS13325 | 2734862..2735152 | + | 291 | WP_000455794.1 | HTH-type transcriptional regulator | - |
| PS053_RS13330 | 2735435..2735647 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| PS053_RS13335 | 2735715..2736401 | - | 687 | WP_059271833.1 | hypothetical protein | - |
| PS053_RS13340 | 2736553..2736705 | - | 153 | WP_001135738.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 2736756..2736810 | + | 55 | - | - | Antitoxin |
| PS053_RS13345 | 2737026..2739095 | - | 2070 | WP_059221279.1 | glycine--tRNA ligase subunit beta | - |
| PS053_RS13350 | 2739105..2740016 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| PS053_RS13355 | 2740112..2740411 | - | 300 | WP_059229187.1 | YsaB family lipoprotein | - |
| PS053_RS13360 | 2740584..2741579 | + | 996 | WP_256879259.1 | acyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5912.14 Da Isoelectric Point: 7.7173
>T271438 WP_001135738.1 NZ_CP117568:c2736705-2736553 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
Antitoxin
Download Length: 55 bp
>AT271438 NZ_CP117568:2736756-2736810 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|