Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2736553..2736810 Replicon chromosome
Accession NZ_CP117568
Organism Escherichia albertii strain BIA_5-2

Toxin (Protein)


Gene name hokA Uniprot ID V0YDF1
Locus tag PS053_RS13340 Protein ID WP_001135738.1
Coordinates 2736553..2736705 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 2736756..2736810 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS053_RS13310 2731939..2732598 + 660 WP_000747625.1 OmpA family lipoprotein -
PS053_RS13315 2732702..2733676 + 975 WP_000804993.1 glyoxylate/hydroxypyruvate reductase GhrB -
PS053_RS13320 2733729..2734439 - 711 WP_002460072.1 DUF3053 domain-containing protein -
PS053_RS13325 2734862..2735152 + 291 WP_000455794.1 HTH-type transcriptional regulator -
PS053_RS13330 2735435..2735647 + 213 WP_000014594.1 RNA chaperone/antiterminator CspA -
PS053_RS13335 2735715..2736401 - 687 WP_059271833.1 hypothetical protein -
PS053_RS13340 2736553..2736705 - 153 WP_001135738.1 type I toxin-antitoxin system toxin HokA Toxin
- 2736756..2736810 + 55 - - Antitoxin
PS053_RS13345 2737026..2739095 - 2070 WP_059221279.1 glycine--tRNA ligase subunit beta -
PS053_RS13350 2739105..2740016 - 912 WP_001168544.1 glycine--tRNA ligase subunit alpha -
PS053_RS13355 2740112..2740411 - 300 WP_059229187.1 YsaB family lipoprotein -
PS053_RS13360 2740584..2741579 + 996 WP_256879259.1 acyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(5-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5912.14 Da        Isoelectric Point: 7.7173

>T271438 WP_001135738.1 NZ_CP117568:c2736705-2736553 [Escherichia albertii]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE

Download         Length: 153 bp

Antitoxin


Download         Length: 55 bp

>AT271438 NZ_CP117568:2736756-2736810 [Escherichia albertii]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LX93

Antitoxin

Download structure file

References